DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and aptx

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_999894.1 Gene:aptx ZFINID:ZDB-GENE-040628-2 Length:324 Species:Danio rerio

Alignment Length:176 Identity:71/177 (40%)
Similarity:96/177 (54%) Gaps:3/177 (2%)


  Fly     3 WSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLA 67
            ||..|...:..|:..:...:..|||.||:|||::|:||||...|.|:..|...|:.||:.:..:|
Zfish   149 WSQGLKASMQDPKMQVYKDDSVVVIKDKYPKARYHWLVLPWQSISSLKALRSEHVELLKHMQRVA 213

  Fly    68 RNVVE-VKGVRWQDFNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTKLYAQ 131
            ..:|| ........|.:|:||.|||..:||||||:||.|..||.|||||||.|:.||....:.:.
Zfish   214 DQMVEQCPDAHKLSFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFTTDYFVESQDVISM 278

  Fly   132 LEKENSISRLPKSLKDELLAKPLICNQCEFVARNLPSLKGHLVGHL 177
            ||.:..:.  .|....|||..||.|:.|......:|.||.||..||
Zfish   279 LEHDGKVQ--VKEGAGELLKLPLRCHVCGKEQTTIPKLKDHLKTHL 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 35/93 (38%)
zf-C2HE 119..179 CDD:292895 20/60 (33%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
aptxNP_999894.1 FHA 5..98 CDD:238017
aprataxin_related 147..247 CDD:238609 38/98 (39%)
Interaction with DNA substrate. {ECO:0000250|UniProtKB:Q7Z2E3} 175..179 3/4 (75%)
Interaction with DNA substrate. {ECO:0000250|UniProtKB:Q7Z2E3} 237..238 1/1 (100%)
Histidine triad motif 240..244 2/4 (50%)
zf-C2HE 266..321 CDD:292895 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198583781
eggNOG 1 0.900 E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005179
OrthoInspector 1 1.000 T1052648
orthoMCL 1 0.900 OOG5_129343
Panther 1 1.100 LDO PTHR12486
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R76
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.