DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and aptx

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_991394.1 Gene:aptx XenbaseID:XB-GENE-1015068 Length:347 Species:Xenopus tropicalis

Alignment Length:178 Identity:67/179 (37%)
Similarity:98/179 (55%) Gaps:9/179 (5%)


  Fly     3 WSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLA 67
            ||..|...:..|...:...:..|||.||:|||::|:||||...|.::..|...||.|::.:|.:.
 Frog   172 WSQGLKASMQDPTMQVFKDDKVVVIKDKYPKARYHWLVLPWQSIANLKVLRAEHLELVQHMHAVG 236

  Fly    68 RNVV-EVKGVRWQDFNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTKLYAQ 131
            :.:. |....:...|.:|:||.|||..:||||||:||.|..||.|||||||.|:.|:....:...
 Frog   237 QKIAKEHSDSKCAPFQLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFTTDYFLESQAMIEM 301

  Fly   132 LEKENSISRLPKSLKD---ELLAKPLICNQCEFVARNLPSLKGHLVGH 176
            ::....:     ::||   |||..||:|:.|.....|:|.||.||..|
 Frog   302 IKTHGKV-----NVKDGVSELLKTPLMCHICRKEQANMPQLKEHLKKH 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 33/93 (35%)
zf-C2HE 119..179 CDD:292895 18/62 (29%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
aptxNP_991394.1 FHA 5..98 CDD:238017
aprataxin_related 169..270 CDD:238609 36/98 (37%)
Interaction with DNA substrate. {ECO:0000250|UniProtKB:Q7Z2E3} 198..202 3/4 (75%)
Interaction with DNA substrate. {ECO:0000250|UniProtKB:Q7Z2E3} 260..261 1/1 (100%)
Histidine triad motif 263..267 2/4 (50%)
zf-C2HE 289..345 CDD:292895 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198588463
eggNOG 1 0.900 E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005179
OrthoInspector 1 1.000 T1059397
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R76
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.