DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aptx and CG15362

DIOPT Version :10

Sequence 1:NP_650805.1 Gene:Aptx / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster


Alignment Length:88 Identity:29/88 - (32%)
Similarity:47/88 - (53%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLARNVVEVKGVRW 78
            |..|.:.::..|:..||:|.|:.|||.:|.....|:..||:||:.|:..:.......:..:.|..
  Fly    46 PPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRMEQGMMEFLRSQNVDP 110

  Fly    79 QDFNVGFHAEP--SMQRLHLHVI 99
            ::..||||..|  |::.||||.|
  Fly   111 KEAIVGFHLPPFISVRHLHLHGI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AptxNP_650805.1 DcpS_C 8..113 CDD:463415 29/88 (33%)
zf-C2HE 118..179 CDD:465082
DcpS_C 235..339 CDD:463415
zf-C2HE 344..406 CDD:465082
KLF1_2_4_N <511..585 CDD:425360
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 29/88 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.