DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5316 and CG15362

DIOPT Version :9

Sequence 1:NP_650805.1 Gene:CG5316 / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster


Alignment Length:88 Identity:29/88 - (32%)
Similarity:47/88 - (53%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLARNVVEVKGVRW 78
            |..|.:.::..|:..||:|.|:.|||.:|.....|:..||:||:.|:..:.......:..:.|..
  Fly    46 PPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRMEQGMMEFLRSQNVDP 110

  Fly    79 QDFNVGFHAEP--SMQRLHLHVI 99
            ::..||||..|  |::.||||.|
  Fly   111 KEAIVGFHLPPFISVRHLHLHGI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 29/88 (33%)
zf-C2HE 119..179 CDD:292895
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 29/88 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.