powered by:
Protein Alignment CG5316 and CG15362
DIOPT Version :9
| Sequence 1: | NP_650805.1 |
Gene: | CG5316 / 42322 |
FlyBaseID: | FBgn0038704 |
Length: | 662 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_608634.1 |
Gene: | CG15362 / 33371 |
FlyBaseID: | FBgn0031378 |
Length: | 168 |
Species: | Drosophila melanogaster |
| Alignment Length: | 88 |
Identity: | 29/88 - (32%) |
| Similarity: | 47/88 - (53%) |
Gaps: | 2/88 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 PENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLARNVVEVKGVRW 78
|..|.:.::..|:..||:|.|:.|||.:|.....|:..||:||:.|:..:.......:..:.|..
Fly 46 PPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRMEQGMMEFLRSQNVDP 110
Fly 79 QDFNVGFHAEP--SMQRLHLHVI 99
::..||||..| |::.||||.|
Fly 111 KEAIVGFHLPPFISVRHLHLHGI 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45464149 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR12486 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.