DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and Aptx

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_017448660.1 Gene:Aptx RGDID:628740 Length:343 Species:Rattus norvegicus

Alignment Length:178 Identity:72/179 (40%)
Similarity:104/179 (58%) Gaps:9/179 (5%)


  Fly     3 WSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLA 67
            ||..|...:..|:..:...:..|||.||:|||:||:||||.|.|.|:..:...||.||:.:|.:.
  Rat   168 WSQGLKISMKDPKMQVYKDDQVVVIKDKYPKARHHWLVLPWASISSLKVVTSEHLELLKHMHAVG 232

  Fly    68 RNVV-EVKGVRWQDFNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTKLYAQ 131
            ..|: :..|.....|.:|:||.|||..:||||||:||.|..||.||||||||||.|:....:...
  Rat   233 EKVIADFTGSSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIKM 297

  Fly   132 LEKENSISRLPKSLKD---ELLAKPLICNQCEFVARNLPSLKGHLVGH 176
            :::...:     ::||   |||..||.|::|:.:..::|.||.||..|
  Rat   298 VQEAGRV-----TVKDGTCELLKLPLRCHECQQLLPSIPQLKEHLRKH 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 37/93 (40%)
zf-C2HE 119..179 CDD:292895 18/62 (29%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
AptxXP_017448660.1 FHA <38..112 CDD:238017
aprataxin_related 165..266 CDD:238609 40/98 (41%)
zf-C2HE 285..341 CDD:292895 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198583524
eggNOG 1 0.900 E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005179
OrthoInspector 1 1.000 T1086946
orthoMCL 1 0.900 OOG5_129343
Panther 1 1.100 LDO PTHR12486
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.