DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and SPCC18.09c

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_588388.1 Gene:SPCC18.09c PomBaseID:SPCC18.09c Length:232 Species:Schizosaccharomyces pombe

Alignment Length:202 Identity:62/203 (31%)
Similarity:91/203 (45%) Gaps:42/203 (21%)


  Fly    11 ISKPE---NLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLN-----RSHLSLLEELHLLA 67
            |..||   |:|...:..|::.|.|||::.| |:|...| |.:.|::     ..|.||:|:|....
pombe    42 IESPESYKNVIYYDDDVVLVRDMFPKSKMH-LLLMTRD-PHLTHVHPLEIMMKHRSLVEKLVSYV 104

  Fly    68 RNVVEVKGVRWQD-----------------FNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWN 115
            :.  ::.|:.:.:                 ..|||||.|||..||||:::.|.||.|||...|:.
pombe   105 QG--DLSGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYI 167

  Fly   116 SFNTELFVPYTKLYAQLEKENSISRLP-KSLKDELLAKPLICNQC-EFVARNLPSLKGHLVGHLQ 178
            ||.:..||         :.:...|.|| :.....|..:.|.|.:| |...|:...||.||.....
pombe   168 SFTSPFFV---------KIDTPTSNLPTRGTLTSLFQEDLKCWRCGETFGRHFTKLKAHLQEEYD 223

  Fly   179 D--PKSV 183
            |  .|||
pombe   224 DWLDKSV 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 34/114 (30%)
zf-C2HE 119..179 CDD:292895 15/62 (24%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
SPCC18.09cNP_588388.1 HIT 45..156 CDD:279559 34/115 (30%)
zf-C2HE 172..224 CDD:292895 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005179
OrthoInspector 1 1.000 T1124851
orthoMCL 1 0.900 OOG5_129343
Panther 1 1.100 LDO PTHR12486
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R76
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.