DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5316 and SPCC18.09c

DIOPT Version :9

Sequence 1:NP_650805.1 Gene:CG5316 / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_588388.1 Gene:SPCC18.09c / 2539198 PomBaseID:SPCC18.09c Length:232 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:62/202 - (30%)
Similarity:91/202 - (45%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISKPE---NLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLN-----RSHLSLLEELHLLA 67
            |..||   |:|...:..|::.|.|||::.| |:|...| |.:.|::     ..|.||:|:|....
pombe    42 IESPESYKNVIYYDDDVVLVRDMFPKSKMH-LLLMTRD-PHLTHVHPLEIMMKHRSLVEKLVSYV 104

  Fly    68 RNVVEVKGVRWQD-----------------FNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWN 115
            :.  ::.|:.:.:                 ..|||||.|||..||||:::.|.||.|||...|:.
pombe   105 QG--DLSGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYI 167

  Fly   116 SFNTELFVPYTKLYAQLEKENSISRLP-KSLKDELLAKPLICNQC-EFVARNLPSLKGHLVGHLQ 178
            ||.:..||         :.:...|.|| :.....|..:.|.|.:| |...|:...||.||.....
pombe   168 SFTSPFFV---------KIDTPTSNLPTRGTLTSLFQEDLKCWRCGETFGRHFTKLKAHLQEEYD 223

  Fly   179 D--PKSV 183
            |  .|||
pombe   224 DWLDKSV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 34/113 (30%)
zf-C2HE 119..179 CDD:292895 15/61 (25%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
SPCC18.09cNP_588388.1 HIT 45..156 CDD:279559 34/114 (30%)
zf-C2HE 172..224 CDD:292895 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003607
OrthoInspector 1 1.000 - - oto101212
orthoMCL 1 0.900 - - OOG6_103324
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R76
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.