DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aptx and hnt3

DIOPT Version :10

Sequence 1:NP_650805.1 Gene:Aptx / 42322 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_588388.1 Gene:hnt3 / 2539198 PomBaseID:SPCC18.09C Length:232 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:62/202 - (30%)
Similarity:91/202 - (45%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISKPE---NLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLN-----RSHLSLLEELHLLA 67
            |..||   |:|...:..|::.|.|||::.| |:|...| |.:.|::     ..|.||:|:|....
pombe    42 IESPESYKNVIYYDDDVVLVRDMFPKSKMH-LLLMTRD-PHLTHVHPLEIMMKHRSLVEKLVSYV 104

  Fly    68 RNVVEVKGVRWQD-----------------FNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWN 115
            :.  ::.|:.:.:                 ..|||||.|||..||||:::.|.||.|||...|:.
pombe   105 QG--DLSGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYI 167

  Fly   116 SFNTELFVPYTKLYAQLEKENSISRLP-KSLKDELLAKPLICNQC-EFVARNLPSLKGHLVGHLQ 178
            ||.:..||         :.:...|.|| :.....|..:.|.|.:| |...|:...||.||.....
pombe   168 SFTSPFFV---------KIDTPTSNLPTRGTLTSLFQEDLKCWRCGETFGRHFTKLKAHLQEEYD 223

  Fly   179 D--PKSV 183
            |  .|||
pombe   224 DWLDKSV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AptxNP_650805.1 DcpS_C 8..113 CDD:463415 40/126 (32%)
zf-C2HE 118..179 CDD:465082 15/62 (24%)
DcpS_C 235..339 CDD:463415
zf-C2HE 344..406 CDD:465082
KLF1_2_4_N <511..585 CDD:425360
hnt3NP_588388.1 HIT 44..156 CDD:395984 34/115 (30%)
zf-C2HE 170..224 CDD:465082 15/62 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.