DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5316 and hint-3

Sequence 1:NP_650805.1 Gene:CG5316 FlyBaseID:FBgn0038704 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001256089.1 Gene:hint-3 WormBaseID:WBGene00016150 Length:200 Species:Caenorhabditis elegans

Alignment Length:164 Identity:44/165 (27%)
Similarity:74/165 (45%) Gaps:37/165 (22%)


  Fly    12 SKPENLIISSEIAVVIADKFPKAQHHYLV-----------LPLADIPSIFHLNRSHLSLLEELHL 65
            :|.|..:..::..|||.|..|||::||||           |.:||:|.:..:.::...||.| ||
 Worm    44 NKKELQLKENKSCVVINDIKPKAKNHYLVLSKQHIAKPTDLTVADVPLLEEMEKTGRELLRE-HL 107

  Fly    66 LARNVVEVKGVRWQD-FNVGFHAEP--SMQRLHLHVI----SKDFVSTSLKTKKHWNSFNTELFV 123
            ..:...:..    :| ..:|||..|  |:..||:|:|    ....:|..|..:.      .::|.
 Worm   108 KKKGEADTV----EDMLRIGFHLPPLLSVHHLHMHIIY
PISDMGLISRKLTFRP------GKVFK 162

  Fly   124 PYTKLYAQLEKENSISRLPKSL-----KDELLAK 152
            |..:|..||:::..:   |..|     ||::..|
 Worm   163 PARELIDQLKEDAGV---PDPLEGNPAKDDVHEK 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5316NP_650805.1 DcpS_C 8..100 CDD:288796 32/106 (30%)
zf-C2HE 119..179 CDD:292895 10/40 (25%)
DcpS_C 235..326 CDD:288796
zf-C2HE 345..405 CDD:292895
hint-3NP_001256089.1 aprataxin_related 35..141 CDD:238609 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.