DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14280 and CG13313

DIOPT Version :9

Sequence 1:NP_001287405.1 Gene:CG14280 / 42312 FlyBaseID:FBgn0038695 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_648267.1 Gene:CG13313 / 39022 FlyBaseID:FBgn0035941 Length:415 Species:Drosophila melanogaster


Alignment Length:404 Identity:104/404 - (25%)
Similarity:172/404 - (42%) Gaps:55/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SSTKSSIMQPHQTLKNILFGSPIKANLILKKPNAPRSKGKGFLSLFEVIKFPNTKCSVSMGDIRS 239
            |....|::..:.|    |......::|:......||     :...:.:.:|.|..|   :|: ..
  Fly    40 SKANESLILANDT----LLAEDGNSSLVHSGSRHPR-----WFPFYTIGRFSNDIC---VGN-NL 91

  Fly   240 MEGVCYHEFECKSLGGIPTESCAE--GVGVCCVFVNGCGDVTSQQILYFESPNYPNAVREMMICV 302
            :.|.|....||....|:...||:.  ...:||::...||..||....||.:.|||........|.
  Fly    92 LLGTCVINGECTDNSGVAAGSCSSITAQAICCIYQRTCGASTSYNNTYFYNSNYPAPYGGGGRCS 156

  Fly   303 LIIN-VKKGVQQLRLDFQMFELSRPS-NGDCVDDQFIVSGHNTNFQIPILCGINTGQHIYIHVGD 365
            :::. ....:.|||:||....|:.|| :|.|..|...::|..:  |:|.:||.|.|||:|:   |
  Fly   157 IVVTPPDSSICQLRVDFLSLSLAPPSGDGSCSTDALTITGGAS--QVPSICGENAGQHVYV---D 216

  Fly   366 SNEGKVYLSVFMKVSGG---GRSFNIKVTQV---DDNLAPNNCLQYFHDAEGVIKSFNYDTDGSI 424
            .| |...:::.:..||.   .|::..::..:   ...|||..||||:..:.|.:.||||::..:.
  Fly   217 FN-GVSPITISVATSGSYTFNRNWQFQIRMLGCTSATLAPAGCLQYYMPSSGTLASFNYNSAAAS 280

  Fly   425 VDN----REATYFNNLNYAICLARLKNVCSVAYNTEQLGGDQPDFQIINKDEA-ENDLISDGQAG 484
            ..|    :......|..|.||:.:...:||:.|:  |:|.|...|.:.|...| :..|::.....
  Fly   281 ALNSIGVQGTRQLANTKYGICIRKAAGMCSITYS--QVGSDTYSFTLTNDVGAVDPTLLATSSVQ 343

  Fly   485 AGIFNCPDDFIAINS-----VPLCGERFNDGRESDDYTIHATVRDTAAGPIILPFRTDS----EY 540
            :.  .|..|:|.|.|     |.:..:||        ..:......|:|.|.::...||.    :.
  Fly   344 SQ--ECTTDYIIIPSPTQGGVAMPSDRF--------CGLGLVSTTTSAKPFVVYTVTDGNEDMDI 398

  Fly   541 VGRGFRLLYKQELC 554
            ..|||.|.|.|..|
  Fly   399 SNRGFYLSYSQNAC 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14280NP_001287405.1 MPDZ_u10 132..>180 CDD:293272 1/4 (25%)
CUB 275..391 CDD:238001 37/120 (31%)
CG13313NP_648267.1 CUB 129..>214 CDD:294042 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29Q0H
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.