DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and ETP1

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_011853.1 Gene:ETP1 SGDID:S000001002 Length:585 Species:Saccharomyces cerevisiae

Alignment Length:523 Identity:165/524 (31%)
Similarity:258/524 (49%) Gaps:122/524 (23%)


  Fly   132 GLIHLYK-KNERKAIKE-------APSNQLCLLAVPATLNCHDLLNFIAP---CHAEIKHIQIVR 185
            |:|.|:| .|....:.|       .....:|:|.||.....||||:|...   .:.::.:.:|:|
Yeast    86 GIIRLFKLSNANNTLNEKEILTIPGDDTMICILFVPTYFTVHDLLHFYIGDDIVNKQVSNFRILR 150

  Fly   186 D---GSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWVSEV--ERSEHGAPPMGH 245
            :   |....|.||::||:...|..|.:.:||.:::.::|:: ||.:.|.|:  ::.....|....
Yeast   151 NQQKGMGFNFTVLIKFRNALDAKNFKEEFNGKSFSRMDPET-CHVISVKEIVFQKKLFQRPAANE 214

  Fly   246 --------------------TELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVC 290
                                .|||||||||||||....|::||.|.|.||..||.||.:|.||||
Yeast   215 DFPYLLTDPFTVKKKKELVKVELPTCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSRCPVC 279

  Fly   291 RH----VQTPGLVE---DSV-CMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQL 347
            ||    :....|::   ||. |..|..||:||||||||:||||||...||..|:..|.|.|||.:
Yeast   280 RHSSLRLSRESLLKQAGDSAHCATCGSTDNLWICLICGNVGCGRYNSKHAIKHYEETLHCFAMDI 344

  Fly   348 GTSSVWDYAGDNFVHRLFQNKSDGKLVASQTEKDEREEKI---DSMQ------------------ 391
            .|..||||||||:||||.||:.|||||......|:....|   |.:|                  
Yeast   345 RTQRVWDYAGDNYVHRLVQNEVDGKLVEVGGSGDDDNNDIGNSDELQNVVYGNRSKNGEKSNSNK 409

  Fly   392 ----------------MEFTYLLTSQLDTQRKYYEERMERLEQEWQNHKATANDAKTEVSELQQL 440
                            :|:..:|.|||::||:|||.:::..:|       ||:|:    |.::.|
Yeast   410 KDGELAANFLRHREYHLEYVQVLISQLESQREYYELKLQEKDQ-------TASDS----SNVESL 463

  Fly   441 QQNMQKEKVNLE--------RKLAQHTAKLKDVQKQLNEERELSKALQSNQSSWHGKYKLLEQQY 497
            :::|:..|:..:        |::||        :.:|.|:..:.:.||:|......|.:.||::.
Yeast   464 KKSMEDLKLQFQVTQKEWQKREMAQ--------KSKLEEDMLVIEGLQANLDHLSKKQEQLEREN 520

  Fly   498 NEFKQTHDAEVTELKEQLRDIMFFLDNQQKL--ANTEIAGGTVT-----GIAEKEPDPNTRRRNR 555
            ...:::..    :|:||::|:||:||:|:|.  |:..:..||:.     |.|  :...:.::||:
Yeast   521 KALEESKQ----DLEEQVKDLMFYLDSQEKFKDADESVKEGTILIQQPHGAA--QASKSKKKRNK 579

  Fly   556 RKK 558
            .||
Yeast   580 NKK 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 26/92 (28%)
zf-RING_2 249..291 CDD:290367 27/42 (64%)
zf-UBP 304..363 CDD:280334 37/59 (63%)
CENP-F_leu_zip 366..517 CDD:287450 43/196 (22%)
DUF4200 396..517 CDD:290574 31/129 (24%)
ETP1NP_011853.1 RRM_ETP1 114..201 CDD:241161 26/88 (30%)
zf-RING_2 238..280 CDD:290367 27/42 (64%)
zf-UBP 301..363 CDD:280334 39/62 (63%)
DivIC <470..547 CDD:299713 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C299771774
eggNOG 1 0.900 E1_KOG0804
Hieranoid 1 1.000
Homologene 1 1.000 H4926
Inparanoid 1 1.050 243 1.000 Inparanoid score I674
Isobase 1 0.950 0 Normalized mean entropy S1679
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 1 1.000 T1135487
orthoMCL 1 0.900 OOG5_128831
Panther 1 1.100 LDO PTHR24007
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R400
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.