DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and ATL3

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_177375.1 Gene:ATL3 AraportID:AT1G72310 Length:324 Species:Arabidopsis thaliana

Alignment Length:251 Identity:48/252 (19%)
Similarity:81/252 (32%) Gaps:106/252 (42%)


  Fly   247 ELPTCPVCLERMDESVDGV----------------LTILCNHAFHASCLMKW--GDSTCPVCRHV 293
            ||.:.|:...|.|...||:                |...|||:||..|:..|  ..||||:||:.
plant   107 ELSSLPIVFFRQDSCKDGLECSICLSELVKGDKARLLPKCNHSFHVECIDMWFQSHSTCPICRNT 171

  Fly   294 -------------QTPGLVEDSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAM 345
                         |.|...|::      ||.:                          .||....
plant   172 VLGPEQASSKRVEQVPDNAENA------GTTN--------------------------NNHDALS 204

  Fly   346 QLGTSS--------VW-----------------DYAGDNFVHRLFQNKSDGKLVASQTEKDEREE 385
            ||.|||        ||                 |.|..|..     ::|...:|...::...|..
plant   205 QLSTSSPEFPTNVLVWGRQDQVSTGNTNVGTQEDGAAGNGA-----SQSQEAVVLDISDSSSRNH 264

  Fly   386 KIDSMQMEFTYL---------LTSQLDTQRKYYEERMERLEQEWQNHKATANDAKT 432
            .:.|......::         :|::|.:.|::    :.|.::...::.:|:|.:.:
plant   265 NVSSSSSSMRFIVEEEEAKSPMTTRLRSLRRF----LSRDKRVGCSNSSTSNSSSS 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162
zf-RING_2 249..291 CDD:290367 18/60 (30%)
zf-UBP 304..363 CDD:280334 14/84 (17%)
CENP-F_leu_zip 366..517 CDD:287450 10/77 (13%)
DUF4200 396..517 CDD:290574 6/47 (13%)
ATL3NP_177375.1 zf-RING_2 126..169 CDD:290367 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.