DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and AT1G72220

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_177367.1 Gene:AT1G72220 AraportID:AT1G72220 Length:413 Species:Arabidopsis thaliana

Alignment Length:354 Identity:74/355 (21%)
Similarity:123/355 (35%) Gaps:116/355 (33%)


  Fly   192 FMVLLEFRSNESALEFYKSYNGSTYNSLEPDS-------------LCHAVW-------------- 229
            |.::.:|.|:.     ....|..||.|...|:             :.|.:|              
plant   100 FFLVAKFFSDS-----VNRVNQGTYQSDNEDNDTVMEEEFQDREQVDHPIWLIRTTGLQQSIINS 159

  Fly   230 --VSEVERSEHGAPPMGHTELPTCPVCLERMDESVDGVLTIL--CNHAFHASCLMKW--GDSTCP 288
              :...:|.:      |..|...|||||...:|  |..|.:|  ||||||.||:..|  ..:.||
plant   160 ITICNYKRGD------GLIERTDCPVCLNEFEE--DESLRLLPKCNHAFHISCIDTWLSSHTNCP 216

  Fly   289 VCR------HVQTP---GLVE-----DSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRAT 339
            :||      .|.||   |.||     ....:|.:|.|                :..|.....|  
plant   217 LCRAGIAMISVTTPRYSGPVEVTPGGSGSHLENDGVD----------------EEDHGEIENR-- 263

  Fly   340 NHTFAMQLGTSSVWDYAGDNFVH-RLFQNKSDGKLVASQTEKDER------------EEKIDSMQ 391
                     ..|.:..:.|:.:. .:::..|||.  .|:||..||            .:.::|:.
plant   264 ---------VDSDFKESDDSDIRIEIYRFDSDGD--GSETETKERVRVLKECMDPNGGDSVNSLS 317

  Fly   392 MEFTYLLTSQLDTQRKYYEERMERLEQEWQNHKATANDAKTEVSELQQLQQNMQKEKVNLERKLA 456
            ...|::  ..:|...|..|.:.|...:  .|.:..|:.::.......||:::....::|     .
plant   318 HTKTHV--ESVDFPGKSCENQSEEFTR--HNGEDEASCSEENGGGSNQLRRSCDSGELN-----G 373

  Fly   457 QHTAKLKDVQKQLNEERELSKALQSNQSS 485
            :.|......|..::     |..|::|.||
plant   374 ETTGDEGKSQSDIS-----SSTLKTNGSS 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 10/71 (14%)
zf-RING_2 249..291 CDD:290367 21/46 (46%)
zf-UBP 304..363 CDD:280334 7/60 (12%)
CENP-F_leu_zip 366..517 CDD:287450 26/133 (20%)
DUF4200 396..517 CDD:290574 16/91 (18%)
AT1G72220NP_177367.1 zf-rbx1 <172..219 CDD:289448 22/49 (45%)
zf-RING_2 176..219 CDD:290367 21/45 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.