DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and BRAP

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_005254001.1 Gene:BRAP HGNCID:1099 Length:633 Species:Homo sapiens

Alignment Length:542 Identity:230/543 (42%)
Similarity:332/543 (61%) Gaps:47/543 (9%)


  Fly    48 GLRQSRDITIETYTN--QRWKRELSEPRQQEMNWVAAVQHVNSPSAGSSREITPRSGDDGQAGAS 110
            |.|:..|:.|||..:  ...|..:.|.:..|.          ||:|..|::.: :...:....:.
Human   106 GRREMTDVIIETMKSNPDELKTTVEERKSSEA----------SPTAQRSKDHS-KECINAAPDSP 159

  Fly   111 ASNFPQEIGYFSGNPIVEVTKGLIHLYKKNERKAIKE--APSNQLCLLAVPATLNCHDLLNFIAP 173
            :...|.:|.:|||||.||:..|::||||.|:..::||  ..|..||:|.|||.:..|||:.|:||
Human   160 SKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAP 224

  Fly   174 CHAEIKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWV--SEVERS 236
            .:..|:.::|:||.:|||:|||::||:...|..||.:.||..:||:| |.:|..|:|  :||.:|
Human   225 FNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIE-DDVCQLVYVERAEVLKS 288

  Fly   237 EHGA--PPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGLV 299
            |.||  |.|..||||.|.||||||||||:|:||.||||:||:.||.:|.|:||||||:.|||..|
Human   289 EDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPV 353

  Fly   300 EDSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHRL 364
            |::.|.||...::|||||||||:|||||...||..||..|.||:||||....||||||||:||||
Human   354 EENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRL 418

  Fly   365 FQNKSDGKLVASQTEKDE-REEKIDSMQMEFTYLLTSQLDTQRKYYEERMERLE----QEWQNHK 424
            ..:|:|||:|..:.|.|. :|||||::|:|::|||||||::||.|:|.::.|:|    :|..|.|
Human   419 VASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMK 483

  Fly   425 ATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQSSWHGK 489
            ....:...:...|:....::.|||.::|||..|...|:..:..:|.||:|::|.|::||.....|
Human   484 TKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNK 548

  Fly   490 YKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKL----ANT--EIAGGTV---------- 538
            .|..|:...|.....|.::||::|||||:||:|:.|||:    |.|  ||..|.:          
Human   549 LKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSP 613

  Fly   539 --TGIAEKEPDPNTRRRNRRKK 558
              :|.:.|.|.    |:.|.|:
Human   614 ASSGGSGKLPS----RKGRSKR 631

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 39/86 (45%)
zf-RING_2 249..291 CDD:290367 30/42 (71%)
zf-UBP 304..363 CDD:280334 38/59 (64%)
CENP-F_leu_zip 366..517 CDD:287450 58/156 (37%)
DUF4200 396..517 CDD:290574 44/125 (35%)
BRAPXP_005254001.1 RRM_BRAP2 201..284 CDD:241162 37/84 (44%)
RING 304..345 CDD:238093 29/41 (71%)
zf-UBP 358..420 CDD:280334 40/62 (65%)
DUF4349 434..599 CDD:305044 63/165 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C299761066
eggNOG 1 0.900 E1_KOG0804
Hieranoid 1 1.000
Homologene 1 1.000 H4926
Inparanoid 1 1.050 421 1.000 Inparanoid score I1771
Isobase 1 0.950 0 Normalized mean entropy S1679
OMA 1 1.010
OrthoDB 1 1.010 D278227at33208
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 1 1.000 T1072130
orthoMCL 1 0.900 OOG5_128831
Panther 1 1.100 LDO PTHR24007
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.