DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and BRIZ2

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001031419.1 Gene:BRIZ2 AraportID:AT2G26000 Length:479 Species:Arabidopsis thaliana

Alignment Length:494 Identity:162/495 (33%)
Similarity:260/495 (53%) Gaps:70/495 (14%)


  Fly   109 ASASNFPQEIGYFSGNPIVEVTKGLIHLYKKNERKAIKEAPSNQL--------CLLAVPATLNCH 165
            :|.|:..|.:.:.||||.:..|:|::||...|...:...:.|:.|        |:|.||..:...
plant    10 SSLSDMIQTVHFSSGNPRIGETRGVMHLISDNAVSSSSSSSSSNLPIGRNPLVCVLGVPNHMTYA 74

  Fly   166 DLLNFIAPCHAEIKHIQIVR----DGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCH 226
            |...|   |.:.|:||..:|    |...|::.:|:.|.|.||...|::.:.|..:|||:.| :|.
plant    75 DFCQF---CGSFIQHILDMRTVRNDDIENRYSILIRFDSQESTDTFFQHFRGKQFNSLDED-VCR 135

  Fly   227 AVWVSEVERS------EHGAP-PMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGD 284
            .::..:|:.:      :|..| ..|..|.|||||||||:|:...|:||.:|||:||.||:..|.|
plant   136 LLFALDVQFTGYSGSIDHTQPSAAGPIEQPTCPVCLERLDQDTGGILTTMCNHSFHCSCISNWPD 200

  Fly   285 STCPVCRHVQTPGLVEDSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGT 349
            |:|||||:.|..  .|:|||..|:.|::||:|:|||.||||||:.|||..|:..|.|.::::|.|
plant   201 SSCPVCRYCQQQ--PENSVCCVCQTTENLWMCVICGVVGCGRYKEGHARRHWEETEHCYSLELET 263

  Fly   350 SSVWDYAGDNFVHRLFQNKSDGKLVA----SQTEKDE---------------REEKIDSMQMEFT 395
            ..||||||||:||||.|:|:|||||.    ....||.               ...|:|.:..|:.
plant   264 QRVWDYAGDNYVHRLIQSKTDGKLVELNSHGSLSKDGCGSCEYSDSGMTDALLNSKVDMIISEYN 328

  Fly   396 YLLTSQLDTQRKYYEERMERLEQEWQNHKATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTA 460
            .||.:||:.|::|:|:.::.:::|        .:.|...:..:.:.|.:||.:...:|     ..
plant   329 ELLQAQLENQKQYFEKLLQNVKEE--------TEQKISEAASKAISQRLQKLQTRFDR-----CV 380

  Fly   461 KLKDVQKQLNEERELSKALQSNQSSWHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQ 525
            |.|...:.|||.      |..|:..|..|...::::..:..:..|.::..|:|||.::|..:|.:
plant   381 KEKQFLEDLNEN------LVKNKDVWSTKITEMKEREKKAVRAKDEKIQGLEEQLGNLMAQMDGE 439

  Fly   526 QKLANT-EIAGGTVTGI------AEKEPDPNTRRRNRRK 557
            .:::.| |:...||:..      |......|.::.||||
plant   440 SEVSETKEVQDATVSTTNTSSSGAGNVIHANKKKSNRRK 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 28/96 (29%)
zf-RING_2 249..291 CDD:290367 27/42 (64%)
zf-UBP 304..363 CDD:280334 33/59 (56%)
CENP-F_leu_zip 366..517 CDD:287450 39/170 (23%)
DUF4200 396..517 CDD:290574 27/121 (22%)
BRIZ2NP_001031419.1 BRAP2 57..148 CDD:284901 26/95 (27%)
RING 166..207 CDD:238093 26/41 (63%)
zf-UBP 218..280 CDD:280334 35/62 (56%)
DUF4200 315..437 CDD:290574 31/141 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4926
Inparanoid 1 1.050 269 1.000 Inparanoid score I905
OMA 1 1.010
OrthoDB 1 1.010 D659103at2759
OrthoInspector 1 1.000 T125051
orthoMCL 1 0.900 OOG5_128831
Panther 1 1.100 O PTHR24007
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.