DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and NIP2

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001189544.1 Gene:NIP2 AraportID:AT2G17730 Length:253 Species:Arabidopsis thaliana

Alignment Length:45 Identity:14/46 (30%)
Similarity:23/46 (50%) Gaps:10/46 (22%)


  Fly   250 TCPVCLE--RMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRH 292
            :|.|||:  ::.|:|..:..  |:|.||..|:..|      :.||
plant   195 SCSVCLQDFQLGETVRSLPH--CHHMFHLPCIDNW------LLRH 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162
zf-RING_2 249..291 CDD:290367 12/43 (28%)
zf-UBP 304..363 CDD:280334
CENP-F_leu_zip 366..517 CDD:287450
DUF4200 396..517 CDD:290574
NIP2NP_001189544.1 Gly-zipper_OmpA <56..>90 CDD:290172
zf-RING_2 194..231 CDD:290367 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.