powered by:
Protein Alignment CG5555 and NIP2
DIOPT Version :9
Sequence 1: | NP_001262724.1 |
Gene: | CG5555 / 42302 |
FlyBaseID: | FBgn0038686 |
Length: | 558 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189544.1 |
Gene: | NIP2 / 816282 |
AraportID: | AT2G17730 |
Length: | 253 |
Species: | Arabidopsis thaliana |
Alignment Length: | 45 |
Identity: | 14/45 - (31%) |
Similarity: | 23/45 - (51%) |
Gaps: | 10/45 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 TCPVCLE--RMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRH 292
:|.|||: ::.|:|..:.. |:|.||..|:..| :.||
plant 195 SCSVCLQDFQLGETVRSLPH--CHHMFHLPCIDNW------LLRH 231
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.