DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and Brap

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_082503.2 Gene:Brap MGIID:1919649 Length:591 Species:Mus musculus

Alignment Length:609 Identity:240/610 (39%)
Similarity:349/610 (57%) Gaps:78/610 (13%)


  Fly     7 NISLCVIKIE--------TDLDPSADSEGAVSAEHPTNPRVLKER-------------------- 43
            ::||.||::|        ||...|| :.|.:|.|.      :|::                    
Mouse     2 SVSLVVIRLELAGHSPVPTDFGFSA-AAGEMSDEE------IKKKTLASAVACLEGKSAGEKAAI 59

  Fly    44 -ERDRGLRQSRDITIETYTNQRWKRELSEPR---QQEMNWVAAVQHVNSPSAGSSREITPRSGDD 104
             .:..|.|:..|:.|||     .|....|.|   :::....|.|....|.....|....|.|   
Mouse    60 IHQHLGRREMTDVIIET-----MKARADEVRDTVEEKKPSAAPVSAQRSREQSESVNTAPES--- 116

  Fly   105 GQAGASASNFPQEIGYFSGNPIVEVTKGLIHLYKKNERKAIKE--APSNQLCLLAVPATLNCHDL 167
                 .:...|.:|.:|||||.||:..|::||||.|:..::||  ..|..||:|.||||:..|||
Mouse   117 -----PSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCVLTVPATMTSHDL 176

  Fly   168 LNFIAPCHAEIKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWV-- 230
            :.|:||.:..|:.::|:||.:|||:|||::|.:...|..||.:.||..:||:| |.:|..|:|  
Mouse   177 MKFVAPFNDVIEQMKIIRDSTPNQYMVLIKFSAQADADSFYMACNGRQFNSIE-DDVCQLVYVER 240

  Fly   231 SEVERSEHGA--PPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHV 293
            :||.:||.||  |.|..||||.|.||||||||||:|:||.||||:||:.||.:|.|:||||||:.
Mouse   241 AEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYC 305

  Fly   294 QTPGLVEDSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGD 358
            |||..||::.|.||...::|||||||||:|||||...||..||..|.||:||||....|||||||
Mouse   306 QTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGD 370

  Fly   359 NFVHRLFQNKSDGKLVASQTEKDE-REEKIDSMQMEFTYLLTSQLDTQRKYYEERMERLE----Q 418
            |:||||..:|:|||:|..:.|.|. :|||||::|:|::|||||||::||.|:|.::.|:|    :
Mouse   371 NYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAE 435

  Fly   419 EWQNHKATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQ 483
            |..|.|....:...:...|:....::.|||.::|||..|...::..:..:|.||:||:|.|::||
Mouse   436 EINNMKTKFKETIEKCDSLELRLSDLLKEKQSVERKCTQLNTRVAKLSTELQEEQELNKCLRANQ 500

  Fly   484 SSWHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKLAN------TEIAGGTVTGIA 542
            .....:.|..|:...|.....|.::||::|||||:||:|:.||::::      .||..|.:....
Mouse   501 LVLQNQLKEEEKLLKETCAQKDLQITEIQEQLRDVMFYLETQQQISHLPAETRQEIQEGQINIAM 565

  Fly   543 EKEPDPNT--------RRRNRRKK 558
            ...|:|.:        .|:.|.|:
Mouse   566 ASAPNPPSSGAGGKLQSRKGRSKR 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 39/86 (45%)
zf-RING_2 249..291 CDD:290367 30/42 (71%)
zf-UBP 304..363 CDD:280334 38/59 (64%)
CENP-F_leu_zip 366..517 CDD:287450 57/156 (37%)
DUF4200 396..517 CDD:290574 43/125 (34%)
BrapNP_082503.2 RRM_BRAP2 159..242 CDD:241162 37/84 (44%)
RING 262..303 CDD:238093 29/41 (71%)
zf-UBP 316..378 CDD:280334 40/62 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C299755636
eggNOG 1 0.900 E1_KOG0804
Hieranoid 1 1.000
Homologene 1 1.000 H4926
Inparanoid 1 1.050 418 1.000 Inparanoid score I1788
Isobase 1 0.950 0 Normalized mean entropy S1679
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 1 1.000 T1082184
orthoMCL 1 0.900 OOG5_128831
Panther 1 1.100 LDO PTHR24007
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R400
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.