DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and Brap

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001258123.1 Gene:Brap RGDID:1586551 Length:591 Species:Rattus norvegicus

Alignment Length:604 Identity:239/605 (40%)
Similarity:353/605 (58%) Gaps:68/605 (11%)


  Fly     7 NISLCVIKIE-TDLDP-SADSEGAVSAEHPTNPRVLKER--------------------ERDRGL 49
            ::||.||::| ....| .||...:.:|...:|..:.|:.                    .:..|.
  Rat     2 SVSLVVIRLELAGHSPVPADFGFSAAAGEMSNEEIKKKTLASAAACLEGKSPGEKAAIIHQHLGR 66

  Fly    50 RQSRDITIETYTNQRWKRELSEPRQQEMNWVAAVQHVNSPSAGSSREITPRSGDDGQA-----GA 109
            |:..|:.|||     .|....|.|...       :...|.:|.||.:   ||.:..::     .:
  Rat    67 REMTDVIIET-----MKASADEFRDTS-------EEKTSSAAPSSAQ---RSREQSESVNTVPDS 116

  Fly   110 SASNFPQEIGYFSGNPIVEVTKGLIHLYKKNERKAIKE--APSNQLCLLAVPATLNCHDLLNFIA 172
            .:...|.:|.:|||||.||:..|::||||.|:..::||  ..|..||:|.||||:..|||:.|:|
  Rat   117 PSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCVLTVPATMTSHDLMKFVA 181

  Fly   173 PCHAEIKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWV--SEVER 235
            |.:..|:.::|:||.:|||:|||::|.:...|..||.:.||..:||:| |.:|..|:|  :||.:
  Rat   182 PFNDVIEQMKIIRDSTPNQYMVLVKFSAQADADSFYMACNGRQFNSIE-DDVCQLVYVERAEVLK 245

  Fly   236 SEHGA--PPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGL 298
            ||.||  |.|..||||.|.||||||||||:|:||.||||:||:.||.:|.|:||||||:.|||..
  Rat   246 SEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEP 310

  Fly   299 VEDSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHR 363
            ||::.|.||...::|||||||||:|||||...||..||..|.||:||||....||||||||:|||
  Rat   311 VEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHR 375

  Fly   364 LFQNKSDGKLVASQTEKDE-REEKIDSMQMEFTYLLTSQLDTQRKYYEERMERLE----QEWQNH 423
            |..:|:|||:|..:.|.|. :|||||::|:|::|||||||::||.|:|.::.|:|    :|..|.
  Rat   376 LVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRVYWENKIVRIEKDTAEEINNM 440

  Fly   424 KATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQSSWHG 488
            |:...:...:...|:....::.|||.::|||..|.:.::..:..:|.||:||:|.|::||.....
  Rat   441 KSKFKETIEKCDSLELRLSDLLKEKQSVERKCTQLSTRVAKLSTELQEEQELNKCLRANQLLLQN 505

  Fly   489 KYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKLAN------TEIAGGTVTGIAEKEPD 547
            |.|..|:...|.....|.::||::|||||:||:|:.||::::      .||..|.:.......|:
  Rat   506 KLKEEERLLKETCAQKDLQITEIQEQLRDVMFYLETQQQISHLPAETRQEIQEGQINIAMASAPN 570

  Fly   548 PNT--------RRRNRRKK 558
            |.:        .|:.|.|:
  Rat   571 PPSSGAGGKLQSRKGRSKR 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 39/86 (45%)
zf-RING_2 249..291 CDD:290367 30/42 (71%)
zf-UBP 304..363 CDD:280334 38/59 (64%)
CENP-F_leu_zip 366..517 CDD:287450 58/156 (37%)
DUF4200 396..517 CDD:290574 44/125 (35%)
BrapNP_001258123.1 RRM_BRAP2 159..242 CDD:241162 37/84 (44%)
RING 262..303 CDD:238093 29/41 (71%)
zf-UBP 316..378 CDD:280334 40/62 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4926
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D278227at33208
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24007
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.