DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and TRIM39

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_067076.2 Gene:TRIM39 HGNCID:10065 Length:518 Species:Homo sapiens

Alignment Length:360 Identity:82/361 (23%)
Similarity:132/361 (37%) Gaps:93/361 (26%)


  Fly   250 TCPVCLERMDESVDGVLTILCNHAFHASCLMKW-----GDSTCPVCRHV----------QTPGLV 299
            :|.||||.:.|.|    .|.|.|.|..:|:.:|     .|..|||||..          |...:|
Human    28 SCSVCLEYLKEPV----IIECGHNFCKACITRWWEDLERDFPCPVCRKTSRYRSLRPNRQLGSMV 88

  Fly   300 E--------------DSVCMECEGTDSLW-------ICLICGHVGCGRYQGGHAAAHFRATNHTF 343
            |              :|:|.:.....||:       :||||                  |.:||.
Human    89 EIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLIC------------------AISHTH 135

  Fly   344 AMQLGTSSVWDYAGDNFVHRLFQ--NKSDGKLVASQTEKDEREEKIDSMQMEFTYLLTSQLDTQR 406
              :..|....|.|...:..:|.:  ...:.||......|...|:|    ..|...|:.|:.....
Human   136 --RAHTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKK----PGELKRLVESRRQQIL 194

  Fly   407 KYYEERMERLEQEWQNHKATANDAKTEVSELQQLQQN---MQKEKVNLERKLAQHTAK------- 461
            :.:||...||::|.|...:...:.:.::  ||:|::|   :..::.:|....|:...|       
Human   195 REFEELHRRLDEEQQVLLSRLEEEEQDI--LQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFE 257

  Fly   462 -LKDVQKQL--NEERELSKALQSNQSSWHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLD 523
             ||||:..|  |..|:...:|.:.....|.....|.::.|..::....|||.:..:|........
Human   258 MLKDVKSTLEKNIPRKFGGSLSTICPRDHKALLGLVKEINRCEKVKTMEVTSVSIELEKNFSNFP 322

  Fly   524 NQ----QKLANTEIAGGTVTGIAEKEPDPNTRRRN 554
            .|    :|:....||..|:        ||.|...|
Human   323 RQYFALRKILKQLIADVTL--------DPETAHPN 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162
zf-RING_2 249..291 CDD:290367 18/46 (39%)
zf-UBP 304..363 CDD:280334 13/66 (20%)
CENP-F_leu_zip 366..517 CDD:287450 36/166 (22%)
DUF4200 396..517 CDD:290574 30/134 (22%)
TRIM39NP_067076.2 RAD18 20..>179 CDD:333230 42/179 (23%)
RING-HC_TRIM39_C-IV 26..69 CDD:319515 17/45 (38%)
RING-HC finger (C3HC4-type) 29..69 CDD:319515 17/44 (39%)
AtpF 175..352 CDD:333342 42/190 (22%)
SPRY_PRY_TRIM39 335..513 CDD:293979 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.