DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and brap

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001002466.1 Gene:brap ZFINID:ZDB-GENE-040718-168 Length:578 Species:Danio rerio

Alignment Length:604 Identity:239/605 (40%)
Similarity:354/605 (59%) Gaps:81/605 (13%)


  Fly     7 NISLCVIKIETDLDPSADSEG----AVS--AEHPTNPRVL----------KERERDR------GL 49
            ::||.||::|. .|.|...:|    |||  :|.....:.|          .:.||..      |.
Zfish     2 SVSLVVIRLEL-ADQSDSPQGFHYCAVSEMSEDEMREKALGSAKATLGGKTDLERGAILHQHLGS 65

  Fly    50 RQSRDITIETYTNQRWKRELSEPRQQEMNWVAAVQHVNSPSAGS--SREITPRSGDDGQAGASAS 112
            |...|:.|||:                           .||.|:  .:|:.....|......|.|
Zfish    66 RVMSDMVIETF---------------------------QPSTGAEEGKEVDVSQTDVNMTPDSPS 103

  Fly   113 -NFPQEIGYFSGNPIVEVTKGLIHLYKKNERKAIKE--APSNQLCLLAVPATLNCHDLLNFIAPC 174
             ..|.:|.:|||||.||:..|::||||.|:..::.|  ..|..||:|.||.|:..|||:.|:||.
Zfish   104 KQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLTEDVRRSAMLCILTVPTTMTSHDLMKFVAPY 168

  Fly   175 HAEIKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWV--SEVERSE 237
            :..::|::|:||.:|||:|||::|||...|..||.:.||..:||:| |::|..|:|  :||.:||
Zfish   169 NDVMEHMKIIRDSTPNQYMVLVKFRSQADADSFYTTRNGRQFNSIE-DAVCQLVYVERAEVIKSE 232

  Fly   238 HGA--PPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGLVE 300
            .||  |.|..||||.|.||||||||||:||||.||||:||:.||.:|.|::|||||:.|||..||
Zfish   233 EGASLPVMDLTELPKCTVCLERMDESVNGVLTTLCNHSFHSQCLQRWEDASCPVCRYCQTPEPVE 297

  Fly   301 DSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHRLF 365
            ::.|.||...::|||||||||:|||||...||..||..|.||:||||....||||||||:||||.
Zfish   298 ENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLV 362

  Fly   366 QNKSDGKLVASQTEKDE-REEKIDSMQMEFTYLLTSQLDTQRKYYEERMERLE----QEWQNHKA 425
            .:|:|||:|..:.|.|. ::||||::|:|::|||||||::||.|:|.::..||    :|..|.||
Zfish   363 ASKTDGKMVQYECEGDTCQDEKIDALQLEYSYLLTSQLESQRIYWENKIVHLEKDTAEEINNMKA 427

  Fly   426 TANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQSSWHGKY 490
            ...:...:...|::....:.|:|.::::|.:|...|:..:.::|.||:|:::.|::|||....:.
Zfish   428 KFKETIDKCDSLERKLNELAKDKQSIDKKCSQLNNKVAKLSQELREEQEMNRCLRANQSQLQAQL 492

  Fly   491 KLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKL----ANT--EIAGGTV---TGIAEKEP 546
            :..|::..:.....|.::.||:|||||:||:|:.||::    |:|  ||..|.:   :..|..:|
Zfish   493 QEEERRVQDTAANKDDQIAELQEQLRDVMFYLETQQQIDRMPADTRQEIQEGQINIASAPAAPQP 557

  Fly   547 DPN-------TRRRNRRKK 558
            .|:       |.|:.|.|:
Zfish   558 GPSAHGSGKMTGRKGRSKR 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 40/86 (47%)
zf-RING_2 249..291 CDD:290367 30/42 (71%)
zf-UBP 304..363 CDD:280334 38/59 (64%)
CENP-F_leu_zip 366..517 CDD:287450 52/156 (33%)
DUF4200 396..517 CDD:290574 39/125 (31%)
brapNP_001002466.1 RRM_BRAP2 144..227 CDD:241162 38/84 (45%)
RING 247..288 CDD:238093 29/41 (71%)
zf-UBP 301..363 CDD:280334 40/62 (65%)
V_ATPase_I 411..>499 CDD:279793 21/88 (24%)
ATP-synt_B <460..>554 CDD:304375 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C299755092
eggNOG 1 0.900 E1_KOG0804
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4926
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D278227at33208
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128831
Panther 1 1.100 LDO PTHR24007
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.