DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and SPAC16E8.13

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_594226.1 Gene:SPAC16E8.13 PomBaseID:SPAC16E8.13 Length:547 Species:Schizosaccharomyces pombe

Alignment Length:511 Identity:178/512 (35%)
Similarity:272/512 (53%) Gaps:78/512 (15%)


  Fly   105 GQAGASASNFPQEIGYFSGNPIVEVTK---GLIHLYKKNERKAIK-EAPSNQLCLLAVPATLNCH 165
            |:....:.:||.     |..|.||.|.   |::|||:....::.: :||...|.:||:|..::..
pombe    42 GEIKLLSMDFPS-----SKVPEVEETSLGHGVVHLYRVFPSESHEFDAPGLILAILAIPLYMSPS 101

  Fly   166 DLLNFIAPCHAE-IKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVW 229
            |:|.|:...|.: |:||::::...||:.|.||:|:...|.:.||..:||..::.::|:: ||.:.
pombe   102 DVLGFLGEKHCKSIQHIRLLKTKDPNRIMALLKFKDQASVIRFYTEFNGKAFSQIDPET-CHVLH 165

  Fly   230 VSEV------ERSEH----------GAPPMGHT-----ELPTCPVCLERMDESVDGVLTILCNHA 273
            :.:|      |.|:.          .:.|...|     |||||.|||||||.|:.|::||:|.|.
pombe   166 IDKVNIKYPMESSDSSSTEQQLVGPSSKPFASTTPALIELPTCVVCLERMDSSITGLITIVCQHT 230

  Fly   274 FHASCLMKWGDSTCPVCRHVQTPGLVE-DSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFR 337
            ||..||.|||:|:|||||:.|.....| .|.|..|.....||||||||::|||||...||..|:.
pombe   231 FHCPCLQKWGNSSCPVCRYTQKVQSSEFQSKCTVCCYDKDLWICLICGNIGCGRYHDAHAKQHYV 295

  Fly   338 ATNHTFAMQLGTSSVWDYAGDNFVHRLFQNKSDGKLVASQTE--------KDEREEKI-DSMQME 393
            .|.|.:||:|.|..||||||||:||||.|:::|||||...|:        ....|.|: |.|.:|
pombe   296 DTAHCYAMELETQRVWDYAGDNYVHRLLQSETDGKLVELSTDGKSSGWTGSSATESKLRDKMGLE 360

  Fly   394 FTYLLTSQLDTQRKYYEERMERLEQEWQNHKATAND---AKTEVSELQQLQQNMQKEKVNL-ERK 454
            :|.:|.|||::||.|||..:..:.|:    .:..|:   .||:::..........:.:|:: |.|
pombe   361 YTQILVSQLESQRLYYESHLSNMSQK----LSRVNEELVLKTKIATASSNANTDLRSRVDISESK 421

  Fly   455 LAQHTAKLKDVQKQL-----NEERELSKALQSNQSSWHGKYKLLEQQYNEFKQ----THDAEVTE 510
            |.:...|||.|..||     |.|.|  |::..|...   :.:.||:| |..|.    :...::.:
pombe   422 LKKRDDKLKRVSSQLEHLKHNYEEE--KSMNENLLV---RIQTLEKQ-NTTKSDQIVSMQFQIND 480

  Fly   511 LKEQLRDIMFFLDNQQKL----ANTEIAGGTVTGIAEKEPDPNTRRRN----RRKK 558
            |.|||||:||.:...|::    .:.|:..||:.     .|:.:|.|.|    ::||
pombe   481 LNEQLRDLMFTISASQEIQKMGQSEELQNGTIV-----LPNNSTVRSNSVKSKKKK 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 26/91 (29%)
zf-RING_2 249..291 CDD:290367 28/42 (67%)
zf-UBP 304..363 CDD:280334 34/59 (58%)
CENP-F_leu_zip 366..517 CDD:287450 51/173 (29%)
DUF4200 396..517 CDD:290574 38/134 (28%)
SPAC16E8.13NP_594226.1 RRM_ETP1 88..170 CDD:241161 26/83 (31%)
RING 207..250 CDD:238093 28/43 (65%)
zf-UBP 262..324 CDD:280334 36/62 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4926
Inparanoid 1 1.050 272 1.000 Inparanoid score I691
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 1 1.000 T1124210
orthoMCL 1 0.900 OOG5_128831
Panther 1 1.100 LDO PTHR24007
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R400
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.