DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and Amfr

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_035917.2 Gene:Amfr MGIID:1345634 Length:639 Species:Mus musculus

Alignment Length:287 Identity:53/288 (18%)
Similarity:93/288 (32%) Gaps:71/288 (25%)


  Fly   251 CPVCLERMDESVDGVLTILCNHAFHASCLMKW--GDSTCPVCRHVQTPGLVEDSVCMECEGTDSL 313
            |.:|.    :|:.....:.|.|.||.|||..|  .|::||.||  .:..:.:.|...|....::|
Mouse   337 CAICW----DSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCR--MSL
NIADGSRAREDHQGENL 395

  Fly   314 WICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHRLFQNKSDGKLVASQT 378
            ...|:......||.         |...|........|.:..:.....|..:......|...||.:
Mouse   396 DENLVPVAAAEGRP---------RLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNS 451

  Fly   379 EKDEREEKIDSMQMEFTYLL----------------------------TSQLDTQRKYYEERMER 415
            :.:....:|..|..:..|.|                            |.:.|:.|......:||
Mouse   452 QLNAMAHQIQEMFPQVPYHLVLQDLQMTRSVEITTDNILEGRIQVPFPTQRSDSLRPALNSPVER 516

  Fly   416 LEQEWQNHKATANDAKTEVSELQQLQQNMQKEKVNLE----------------------RKLAQH 458
            ...:.:..:|:....:..:....:|::.:...:|.||                      |.|.|.
Mouse   517 PSPDLEEGEASVQTERVPLDLSPRLEETLDFSEVELEPIEVEDFEARGSRFSKSADERQRMLVQR 581

  Fly   459 TAKLKDVQKQLNEERELSKALQSNQSS 485
                ||...|...:|.|:|:.:.:.:|
Mouse   582 ----KDDLLQQARKRFLNKSSEDDGAS 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162
zf-RING_2 249..291 CDD:290367 15/42 (36%)
zf-UBP 304..363 CDD:280334 9/59 (15%)
CENP-F_leu_zip 366..517 CDD:287450 27/171 (16%)
DUF4200 396..517 CDD:290574 22/141 (16%)
AmfrNP_035917.2 HRD1 82..>378 CDD:227568 16/47 (34%)
zf-RING_2 335..375 CDD:290367 15/42 (36%)
CUE_AMFR 454..494 CDD:270604 4/40 (10%)
VCP/p97-interacting motif (VIM). {ECO:0000250|UniProtKB:Q9UKV5} 618..636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.