DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and brap-2

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_495016.1 Gene:brap-2 WormBaseID:WBGene00017144 Length:590 Species:Caenorhabditis elegans

Alignment Length:597 Identity:200/598 (33%)
Similarity:318/598 (53%) Gaps:92/598 (15%)


  Fly    20 DPSADSEGAVSAEHP---------TNP-RVLKERERD---------------RGLRQSRDITIET 59
            |..|.||..::.|..         |.| :.||.||.|               :|.|...::.||:
 Worm    27 DSKAGSESPLAGERTRQRLVKKGNTPPKKELKGREEDPPIGVMSSEPSHNYHKGRRTYSEVVIES 91

  Fly    60 YTNQRWKRELSEPRQQEMNWVAAVQHVNSPS--AGSSREITPRSGDDGQAGASASNFPQEIGYFS 122
            ...::.                    |:|.|  ||:|.:...||..:|.        |.::.|:|
 Worm    92 LDGEKL--------------------VDSSSSVAGTSEKSGGRSVSEGP--------PDQVAYYS 128

  Fly   123 GNPIVEVTKGLIHLYKKNERKAIKEAPSNQLCLLAVPATLNCHDLLNFIAPCHAEIKHIQIVRDG 187
            |||:.|.|:|::|.||.|:.|..|.|....||:.||||.:...::::|:......|..|::|||.
 Worm   129 GNPLTEKTEGIMHFYKYNDEKLTKVAQCRMLCMYAVPAQVEVREIISFMCISLPMIVSIKVVRDP 193

  Fly   188 SPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWVSEVE----RSEHGAPPMGHTEL 248
            :|||:|::::|:.:..|:.||:.:|...:|.|| ...|...:|..:|    .....:.....|||
 Worm   194 APNQYMLIIKFKEHNDAVTFYEEFNNCPFNDLE-SYCCTLFFVDRIECTTSNDLFSSDDTSLTEL 257

  Fly   249 PTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGLVEDSVCMECEGTDSL 313
            |||.|||||||   |.||.|||||:|||.||.:|.|:||||||:||:|.:|.:..|.:|..::.|
 Worm   258 PTCAVCLERMD---DSVLAILCNHSFHARCLEQWADNTCPVCRYVQSPEVVAEQRCNDCGMSNDL 319

  Fly   314 WICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHRLFQNKSDGKLVASQT 378
            |||||||::|||||...||..|:..|:||:::::|...||||||||:||||.:|.:|||||..|.
 Worm   320 WICLICGNIGCGRYAEQHAQRHWELTSHTYSLKVGGERVWDYAGDNYVHRLIENGADGKLVEYQR 384

  Fly   379 EK----DERE----EKIDSMQMEFTYLLTSQLDTQRKYYEERMERLEQEWQNHKATA-------- 427
            |.    |::.    :|::.:::|:|.||||||:.||||:|.....:||.....:.||        
 Worm   385 ESNASFDDKNQKGGDKLEGIKLEYTLLLTSQLEDQRKYFEGLRHDMEQTMSKMEKTAYAQVENLE 449

  Fly   428 ---NDAKTEVSELQ-QLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQSSWHG 488
               .:..||:..|: .|...:...|| .|::..|...|:..:..:|.:|||:::.|:.:|..|.|
 Worm   450 HQLTERSTELKSLKGDLDDTVTARKV-AEKRATQTNEKVNKLANELKDEREINQMLRKDQQVWKG 513

  Fly   489 KYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKLANTEIAGGTVT--GIAEKEPD---- 547
            :.:.|.:.....:..::.::.:|:.|:.|::...:.|.|| ..::..|.:|  .|.|.:.:    
 Worm   514 QVEKLIESQKTARTEYEKKIEDLQSQVNDLLMHFETQNKL-KEQLDAGKITQEEITESQVELDSS 577

  Fly   548 -PNTRRRNRRKK 558
             .::|:.||:||
 Worm   578 SSSSRKLNRKKK 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 26/84 (31%)
zf-RING_2 249..291 CDD:290367 30/42 (71%)
zf-UBP 304..363 CDD:280334 32/59 (54%)
CENP-F_leu_zip 366..517 CDD:287450 47/171 (27%)
DUF4200 396..517 CDD:290574 35/133 (26%)
brap-2NP_495016.1 RRM_BRAP2 156..239 CDD:241162 26/84 (31%)
RING 259..297 CDD:238093 29/41 (71%)
zf-UBP 310..369 CDD:280334 32/59 (54%)
TPR_MLP1_2 443..559 CDD:285204 24/118 (20%)
LRS4 489..>571 CDD:255978 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C299753406
eggNOG 1 0.900 E1_KOG0804
Hieranoid 1 1.000
Homologene 1 1.000 H4926
Inparanoid 1 1.050 341 1.000 Inparanoid score I1378
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D278227at33208
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 1 1.000 T474004
orthoMCL 1 0.900 OOG5_128831
Panther 1 1.100 LDO PTHR24007
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R400
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.