DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5555 and brap

Sequence 1:NP_001262724.1 Gene:CG5555 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_002937733.1 Gene:brap XenbaseID:XB-GENE-491855 Length:585 Species:Xenopus tropicalis

Alignment Length:602 Identity:238/603 (39%)
Similarity:356/603 (59%) Gaps:70/603 (12%)


  Fly     7 NISLCVIKIE----------------TDLDPSADSEGA--VSAEH-----PTNPRVLKERERDRG 48
            ::||.||::|                |::......|..  |:|.:     |.:...:..:.  .|
 Frog     2 SVSLVVIRLELADHSRFPVGFQYCAATEMSDEEVKENTLHVAATYLEGKLPVDKTAILHQH--IG 64

  Fly    49 LRQSRDITIETYTNQRWKRELSEPRQQEMNWVAAVQHVNSPSAGSSREITPRSGDDGQA------ 107
            .|:..|:.|||..        ..|..:    |::.:.::.|.|     :|.::..|.|.      
 Frog    65 RREMTDMIIETLG--------PSPDVK----VSSTEKMDEPLA-----VTNKASMDEQGICAMAV 112

  Fly   108 -GASASNFPQEIGYFSGNPIVEVTKGLIHLYKKNERKAIKE--APSNQLCLLAVPATLNCHDLLN 169
             .:.:...|::|.:|||||.||:..|::||||.|:..::||  ..|..||:|.||||:..|||:.
 Frog   113 PDSPSKQLPEQITFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPATMTSHDLMK 177

  Fly   170 FIAPCHAEIKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWV--SE 232
            |:|..:..|:|::|:||.:|||:|||::|.|...|..||.:.||..:||:|.| :|..|:|  :|
 Frog   178 FVASFNEVIEHMKIIRDSTPNQYMVLIKFSSQADADSFYMANNGRQFNSIEED-VCQLVYVERAE 241

  Fly   233 VERSEHGA--PPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQT 295
            |.:||.||  |.|..||||.|.||||||||||:|:||.||||:||:.||.:|.|:||||||:.||
 Frog   242 VLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWEDTTCPVCRYCQT 306

  Fly   296 PGLVEDSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNF 360
            |..||::.|.||...::|||||||||:|||||...||..||..|.||:||||....||||||||:
 Frog   307 PEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNY 371

  Fly   361 VHRLFQNKSDGKLVASQTEKDE-REEKIDSMQMEFTYLLTSQLDTQRKYYEERMERLE----QEW 420
            ||||..:|:|||:|..:.|.|. ::|||||:|:|::|||||||::||.|:|.::.|||    :|.
 Frog   372 VHRLVASKTDGKIVQYECEGDTCQDEKIDSLQLEYSYLLTSQLESQRIYWENKIVRLEKDTAEEI 436

  Fly   421 QNHKATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQSS 485
            .|.||...:...:...|:....::.|||..:||:.||..:|:..:..:|.||:|::|.|::||:.
 Frog   437 NNMKAKFKETIDKCDSLEHRLNDLSKEKQAVERRCAQLNSKVAKLSTELKEEQEMNKCLRANQTM 501

  Fly   486 WHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKL----ANT--EIAGGTVTGIAEK 544
            ...:.:..|....|..:..|.::.|::|||||:||:|:.|||:    |:|  ||..|.:...:..
 Frog   502 LQSRLREEEIMRKETCEQKDVQLLEMQEQLRDVMFYLETQQKINHMPADTRQEIQDGQINIASPS 566

  Fly   545 EPDPN---TRRRNRRKK 558
            .|..:   :.|:.|.|:
 Frog   567 SPAASGKLSSRKGRGKR 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 40/86 (47%)
zf-RING_2 249..291 CDD:290367 30/42 (71%)
zf-UBP 304..363 CDD:280334 38/59 (64%)
CENP-F_leu_zip 366..517 CDD:287450 57/156 (37%)
DUF4200 396..517 CDD:290574 43/125 (34%)
brapXP_002937733.1 RRM_BRAP2 158..241 CDD:241162 38/84 (45%)
RING 261..302 CDD:238093 29/41 (71%)
zf-UBP 315..377 CDD:280334 40/62 (65%)
Cortex-I_coil 412..511 CDD:286397 32/99 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C299757675
eggNOG 1 0.900 E1_KOG0804
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4926
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D278227at33208
OrthoFinder 1 1.000 FOG0004145
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.