DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42359 and vma21

Sequence 1:NP_732404.2 Gene:CG42359 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001343090.1 Gene:vma21 PomBaseID:SPCC1235.16 Length:88 Species:Schizosaccharomyces pombe

Alignment Length:95 Identity:26/96 (27%)
Similarity:52/96 (54%) Gaps:12/96 (13%)


  Fly    29 VEHHTQQEDTS-----AEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLTA 88
            :|..:|..||:     ..|.|..:.:||.:||||.:.::.....|.:.:..|       ::.|:|
pombe     1 MERKSQVSDTNNNSIPTNVLLKFVGFSVALFTLPLITYFWTLKTLFKGYQTL-------YAGLSA 58

  Fly    89 VVVVNLVVAMYVLKAFREKPPPPLEPVQQD 118
            .|:||:::|:|::.||||....|.:.::::
pombe    59 AVMVNIILALYIVAAFREDSGTPKKDIKRE 88

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42359NP_732404.2 VMA21 41..>84 CDD:286525 10/43 (23%)
vma21NP_001343090.1 VMA21 19..74 CDD:312820 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.