DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nanos and nos-1

DIOPT Version :10

Sequence 1:NP_476658.1 Gene:nanos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_496358.1 Gene:nos-1 / 191735 WormBaseID:WBGene00003783 Length:311 Species:Caenorhabditis elegans


Alignment Length:154 Identity:45/154 - (29%)
Similarity:63/154 - (40%) Gaps:44/154 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNN 299
            |..|.|. ||:      :|  |:||..              |...|......|:...:||:.|.|
 Worm   175 LQEYLEQ-NNL------LP--PSTMPF--------------GENSGFHGYNPQMNVHNNSTRNGN 216

  Fly   300 NNNKVYKRYNSKAKEISR--H---CVFCENNNEPEAVINS--------------HSVRDNFNRVL 345
            ..|: .:|.||.:.....  |   |.||.......|.:::              |..:.. .||:
 Worm   217 VENR-EQRNNSTSPPRGNPPHPLCCCFCFGTASEFARLHTLPAPRKDDRGPWSDHCSKKR-GRVV 279

  Fly   346 CPKLRTYVCPICGASGDSAHTIKY 369
            |||||:.||.||||:||:|||.|:
 Worm   280 CPKLRSMVCGICGATGDNAHTTKH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nanosNP_476658.1 NBR_nanos 135..182 CDD:467849
zf-nanos 319..372 CDD:461728 24/65 (37%)
nos-1NP_496358.1 zf-nanos 240..304 CDD:461728 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.