DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cdi and tesk2

Sequence 1:NP_524401.2 Gene:cdi FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:XP_012816769.1 Gene:tesk2 XenbaseID:XB-GENE-954759 Length:664 Species:Xenopus tropicalis

Alignment Length:845 Identity:273/846 (32%)
Similarity:367/846 (43%) Gaps:250/846 (30%)


  Fly    53 DATAEAPVKHQPLHNGGWIGNGLPPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDFVKEKIG 117
            ::.|..|.:.:.:.:||..|.      :|:.   .|:.| ||..||.:|.|.|..:|||..||||
 Frog     7 NSIAGFPPRLERIEDGGRDGG------ITQL---GRVYT-SSYSALISAFSRLTRLDDFTCEKIG 61

  Fly   118 SGFFSEVYKVTHRTTGQVMVLKMNQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHALT 182
            |||||||:||.|||:.|||.||||:|.:||.|||:||||:|:|||.|||.||||||.:|||||||
 Frog    62 SGFFSEVFKVRHRTSDQVMALKMNKLSSNRANMLKEVQLMNRLSHPNILRFMGVCVHQGQLHALT 126

  Fly   183 EYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQ--Y 245
            ||||.|:|||||.:.: .|:.|.:::|||.||.|::|:|..|||||||||||.||:   :|:  |
 Frog   127 EYINSGNLEQLLDSNQ-HLTWTVRVKLALDIALGLAYLHSKGIFHRDLTSKNCLIK---SDESGY 187

  Fly   246 EAVVGDFGLAAKIPVKSRKS-RLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEAD 309
            .|||.|||||.|||..|..| :|..||||||::||.|:.:.||:.:||||:|||.|||||||:||
 Frog   188 SAVVADFGLAEKIPDYSEGSEKLAVVGSPYWMAPEVLRDEPYDEKADVFSYGIILCEIIARIQAD 252

  Fly   310 PDMMPRTASFGLDYLAFVELCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEKYEHES 374
            ||.:|||.:|||||..|..:.. |.||.||:|.|.||..|.|.||:|.|..|:|..:|.:..:| 
 Frog   253 PDYLPRTENFGLDYDGFQHMVG-DCPPDFLQLTFNCCNMDPKLRPSFIDIAKQLENILNRLRNE- 315

  Fly   375 SAGASPLSSLELINCSPGGSDSENVTLTPRASVPTVATICTAPAGTLTPRHLQEVDEDGFRFPSK 439
                                                                             
 Frog   316 ----------------------------------------------------------------- 315

  Fly   440 KSASAALPGTPNGSAGSSGFDDHILKSRVRRATQKLEAEILLHRRSLSENIIH---FPMHTSPSD 501
                                                |||  ..|:.||||.|.   ..:...|:|
 Frog   316 ------------------------------------EAE--RERKDLSENNIEPKPISLAKGPND 342

  Fly   502 KARCHQMQRQRSSTHSPTPPRQLSSVQLPATSIPDPPPLPK----------PVPAVLTLRKVG-- 554
            |  |..::|             |.|:......||...|.|:          .:.|...||||.  
 Frog   343 K--CQGVKR-------------LISMVPQDDKIPQKSPRPRRNITLSRSQSDIFARKPLRKVNVQ 392

  Fly   555 DPQYKPTSEKDHNGS--KPNPFEALAQLRGVKKILDANPKTYAAGVGDLFSSCFEMLAPFFKELA 617
            ||.|.|:     .|:  |.|||.|...|:|..|..|...|:..:.|.||.|              
 Frog   393 DPFYTPS-----KGAVRKVNPFSAREDLKGRIKFFDMPSKSVISHVFDLHS-------------- 438

  Fly   618 AMQSKAGAQGGGTSTEETSTGNK----ASAATPSEPKSLPVSPHMTR-------------KYSAI 665
              ..:.|:...|||.:.....::    .|.......:||||||.:.|             |:...
 Frog   439 --PKRDGSLAAGTSGQIRQLLSQDIVDFSIIPRRRCRSLPVSPELLRKDCTSSGLSCTVGKFDPA 501

  Fly   666 EL--RLPQRISNAAPPAVTSAPP-----PSIALPTDED-DCDDCNSEGEDPDGGGNCADAESSSD 722
            :|  .:.|::.::...:|...||     |......||| ||.|.....|   ..|.|.....:..
 Frog   502 QLGSEVRQKLLSSVKYSVQDIPPFRPRSPEYLQANDEDMDCTDATFTQE---ANGFCPGRTENKV 563

  Fly   723 DSAVRPSTVPTARKYRANSLYAHPLFRGSNGTSMKSTSTGEFESPTLLKASASTITLTASVGATN 787
            .:......|       :|..:||...:..|..|.:..|...|.|                     
 Frog   564 QAYYNQLLV-------SNKKHAHCSQKSLNSYSEEENSFDLFSS--------------------- 600

  Fly   788 SCEDLTESARKSKEQASSGATAAVQA------LPTPMSGCSTRLVETPV-------SVSSCTDLE 839
                  ..|.:.:|:.|...:.|:.|      .||.:.|.:...:|..|       |:|||..|:
 Frog   601 ------SEAMEIEEETSQNLSTALSASSISFSSPTRVGGVTLLPLENTVADSKDSPSLSSCRILQ 659

  Fly   840  839
             Frog   660  659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 156/253 (62%)
PKc_like 116..370 CDD:304357 156/257 (61%)
tesk2XP_012816769.1 TyrKc 58..305 CDD:197581 156/252 (62%)
PKc_TESK 60..312 CDD:271057 156/257 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.