DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cdi and si:dkeyp-75h12.2

Sequence 1:NP_524401.2 Gene:cdi FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:XP_009301412.1 Gene:si:dkeyp-75h12.2 ZFINID:ZDB-GENE-030131-7512 Length:653 Species:Danio rerio

Alignment Length:667 Identity:249/668 (37%)
Similarity:333/668 (50%) Gaps:133/668 (20%)


  Fly    85 SSDRLVTG---------SSCRALRTAVSALYSVDDFVKEKIGSGFFSEVYKVTHRTTGQVMVLKM 140
            :||.|:.|         ||.||||:|||:|..:|||:.|||||||||||:||.||:|||||.|||
Zfish    14 ASDSLMHGVHGAHRPRPSSYRALRSAVSSLARLDDFICEKIGSGFFSEVFKVQHRSTGQVMALKM 78

  Fly   141 NQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVLSATQ 205
            |.:.:|:.|||:||||:|:|.|.|||.|:||||.||.|||||||||||:||||| |.:|:||.:.
Zfish    79 NTMASNKANMLKEVQLMNRLRHPNILRFVGVCVHEGHLHALTEYINGGNLEQLL-NSDVLLSWSV 142

  Fly   206 KIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLAAKIP---VKSRKSRL 267
            :|.|:|.||||:.|:|..|||||||||||.|:| ..|....|||||||||.|||   .::.|..|
Zfish   143 RINLSLDIARGLQYLHSKGIFHRDLTSKNCLVR-WENGHCTAVVGDFGLAEKIPDHSEEAEKQSL 206

  Fly   268 ETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLAFVELCPM 332
            ..||||||::||.|:|:.|::..|||::|||.||||.||:||||.:|||..||||..|| .|...
Zfish   207 AVVGSPYWMAPEVLRGERYNEKVDVFAYGIILCEIIGRIQADPDFLPRTEDFGLDVEAF-RLMVE 270

  Fly   333 DTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEKYEHES--------------SAGASPLS- 382
            |.|..|..||..||.....|||.|.:...:    |||.|.:.              |..::||| 
Zfish   271 DCPAHFFNLAVVCCGMSPDSRPCFSEVVAE----LEKRESDELQTDHLESDVQDQMSTSSTPLSR 331

  Fly   383 --SLELINCSPGGSDSENVTLTPRASVPTVATICTAPAGTLTPRHL----QEVDEDG-----FRF 436
              ||::.: .|....|::..|.|.:.:          ....||..:    |..|.:|     |..
Zfish   332 AHSLDIAS-DPVLCRSKSAVLLPPSPI----------LNNTTPMRVNPFSQRQDLNGGRIKLFDT 385

  Fly   437 PSKK--SASAALPGTPNGSAGSSGFDDHILKSRVRRATQKLEAEILLHRRSLSENIIHFPMHTSP 499
            |||.  |.:..||..|:.|:.        :..|..|.||.|..:                    |
Zfish   386 PSKSVISLTFTLPPPPDPSSP--------VPPRSHRRTQSLPCK--------------------P 422

  Fly   500 SDKARCHQMQRQRSSTHSPTPPRQLSSVQLPATSIPDPPPLPKPVPAVLTLRKVGDPQYKPTSEK 564
            .|....:....:|.: |.....|.::.:::...|:     |.....::..|..|.||        
Zfish   423 QDIQSLYSTAEKRMN-HQSIMDRDVNMLEIGGDSV-----LTMSSGSIADLSGVLDP-------- 473

  Fly   565 DHNGSKPNPFEALAQLRGVKKILDANPKTYAAGVG-DLFSSCFEMLAP----FFKELAAMQSKAG 624
            :..||.|...|.| :||....:.|      .:|:. ||     |:|:|    ..:||....|...
Zfish   474 NTTGSNPEQEENL-ELRSQDVLAD------DSGLPLDL-----EVLSPNKWRSTEELMDCTSSPD 526

  Fly   625 AQGGGT-STEETSTGNKASAATPSEPKSLPVSPHMTRKYSAIELRLP----QRISNAAPPAVTSA 684
            ...|.. ||::.|.|  .|:...:.|.|||....:....|.|.:..|    ...||.|...:|  
Zfish   527 TLDGAVDSTKQFSNG--WSSPVSNGPPSLPPLLDLDNNNSTIPINRPLGWGVNNSNGATTPLT-- 587

  Fly   685 PPPSIALPTDEDDCDDC 701
                   ||::|:...|
Zfish   588 -------PTEQDEVVSC 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 150/253 (59%)
PKc_like 116..370 CDD:304357 151/257 (59%)
si:dkeyp-75h12.2XP_009301412.1 PKc_like 54..302 CDD:328722 149/255 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_2QTCP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597363
orthoMCL 1 0.900 OOG5_132405
Panther 1 1.100 O PTHR46485
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.