DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cdi and si:ch211-113e8.3

Sequence 1:NP_524401.2 Gene:cdi FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:XP_021332499.1 Gene:si:ch211-113e8.3 ZFINID:ZDB-GENE-090312-74 Length:657 Species:Danio rerio

Alignment Length:756 Identity:265/757 (35%)
Similarity:354/757 (47%) Gaps:152/757 (20%)


  Fly    73 NGLPPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDFVKEKIGSGFFSEVYKVTHRTTGQVMV 137
            |..|..|....:.....:..||.||||:|||:|..:|||..|||||||||||:||.||.|||||.
Zfish     6 NQEPCEPPLHALYGPNRIRPSSYRALRSAVSSLARIDDFFCEKIGSGFFSEVFKVQHRITGQVMA 70

  Fly   138 LKMNQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVLS 202
            ||||.|.:|:.||||||||:|:|.|.|||.|:||||.||||||||||||||:||||| :.::.||
Zfish    71 LKMNTLASNKANMLREVQLMNRLCHPNILRFLGVCVHEGQLHALTEYINGGNLEQLL-DSDIYLS 134

  Fly   203 ATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLAAKIPVKS---RK 264
            .|.:|.|:|.||||:.|:|..|||||||||||.|:| ..|..:.|||||||||.|||..|   .|
Zfish   135 WTVRIGLSLDIARGLQYLHSKGIFHRDLTSKNCLVR-CENGAFTAVVGDFGLAEKIPDYSDGVEK 198

  Fly   265 SRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLAFVEL 329
            ..|..||||||::||.|:|:.|::..|||::|||.||||||||||||::|||..||||...|..:
Zfish   199 QPLAVVGSPYWMAPEMLRGELYNEKVDVFAYGIILCEIIARIEADPDILPRTEDFGLDVDTFEHM 263

  Fly   330 CPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEKYEHESSAGASPLSSLELI------- 387
            .. |.||.||::|..||..:|.|||.|    .::.::||:.|.|......|: .||.|       
Zfish   264 VG-DCPPSFLQMAVDCCNMNADSRPAF----SEIVVMLERIERERVKSEIPV-ILEPIAIDVSPY 322

  Fly   388 --NCSPGGSDSENVTLTPRASVPTVATICTAPAGTLTPRHLQEVDEDG-----FRFPSKK--SAS 443
              ..||.....:.::.:....:|...:.|......:.|..|:: |.:|     |..|||.  |.:
Zfish   323 RRRSSPCHPCDQRLSRSQSDMLPPATSPCLGTPARVNPFSLRQ-DLNGGRIKLFDTPSKSVISLT 386

  Fly   444 AALPGTPNGSA-----GSSGFDDHILKSRVRRATQKLEAEILLHRRSLSENIIHFPMHTSPSDKA 503
            ..||..|:.||     ||.|......:.|....|.:|..::              |......::.
Zfish   387 FTLPPPPDPSASPPLSGSPGLRGPPRRCRSLPCTPELGRQL--------------PFRDQEVEED 437

  Fly   504 RCHQMQRQRSSTHSPTPPRQLSSVQLPATSIPDPPPLPKPVPAVL-----TLRKVGDPQYKPTSE 563
            |..::.::       |..::|...|   .::.|.       ..||     :|.:|.:.:.....|
Zfish   438 RSEELGQE-------TKDKELEGQQ---DAVEDS-------GLVLDLDMVSLERVEEEEEDEEVE 485

  Fly   564 KDHNGSKPNPFEALAQLRGVKKILDANPKTYAAGVGDLFSSCFEMLAPFFKELAAMQSKAGAQGG 628
            |: ..|...|.:.           .::|.|....|                     ..|....|.
Zfish   486 KE-GQSLTEPMDC-----------SSSPDTTEGNV---------------------SGKRLISGS 517

  Fly   629 GTSTEETSTGNKASAATP--SEPKSLPVSPHMTRKYSAIELRLP---QRISNAAPPAVTSAPPPS 688
            ..|:...|.|    .|||  :.|..||..|.:......:....|   .|::....||....|   
Zfish   518 SYSSSLQSNG----WATPISNGPPLLPPLPRLDNNNGVLRPGRPFAWVRLNGYRGPAPEPLP--- 575

  Fly   689 IALPTDEDDCDDCNSEGEDPDGGGNCADAESSSDDSAVR---PS-TVPTARKYRANSLYAHPLFR 749
               ||::||...|.:          |..|..|.....:|   || ..|..|.||.        |.
Zfish   576 ---PTEQDDVISCPA----------CCLAGFSFPSLCLRGAPPSRRGPPRRPYRT--------FN 619

  Fly   750 GSNGTSMKSTSTGEFESPTLLKASASTITLTASVGATNSCE 790
            |  |.:..:|:.|      ||...|     |....:|.|||
Zfish   620 G--GDASTATAKG------LLCRGA-----TGLAPSTASCE 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 155/253 (61%)
PKc_like 116..370 CDD:304357 155/257 (60%)
si:ch211-113e8.3XP_021332499.1 PKc_TESK 49..303 CDD:271057 157/261 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_2QTCP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597363
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46485
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.