DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cdi and zgc:113162

Sequence 1:NP_524401.2 Gene:cdi FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:XP_021324511.1 Gene:zgc:113162 ZFINID:ZDB-GENE-050522-530 Length:361 Species:Danio rerio

Alignment Length:380 Identity:150/381 (39%)
Similarity:210/381 (55%) Gaps:51/381 (13%)


  Fly     7 SGPGPPSEICGLSVDQVD---------SSAASPFIWPSTAGMCTTATTVTTSTNGDATAEAPVKH 62
            |||.|..| |.....:.|         :|..:.  |...:.||..          |.|.|     
Zfish     9 SGPAPDLE-CKTQSKETDHRHLLMMHMNSLLNR--WNEISKMCEV----------DETTE----- 55

  Fly    63 QPLHNGGWIGNGLPPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDFVKEKIGSGFFSEVYKV 127
                         |.:|...:.|:|..........|||.|..|...:||..|.||:||||:||||
Zfish    56 -------------PVSPTLLSESTDTYCQTDCWHPLRTTVRKLEFWEDFSAELIGTGFFSKVYKV 107

  Fly   128 THRTTGQVMVLKMNQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHALTEYINGGSLEQ 192
            .|.||.:|||:|:.:...::.:::||:.||.||||.||:.::|:||:|.:|:.:.||::||.||:
Zfish   108 MHGTTKKVMVVKIYKNDVDQNSIVREISLLQKLSHPNIVRYLGICVKENKLYPILEYVSGGCLEE 172

  Fly   193 LLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLAAK 257
            |||..:|.|...:||.|...|:|||:|:|...|:||||.|||.||| :::...||||.|||||.:
Zfish   173 LLARADVSLCWREKIELGCDISRGMAYLHYKNIYHRDLNSKNCLIR-MSSRGREAVVTDFGLARE 236

  Fly   258 I---PVKSRKSRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASF 319
            :   |......:|..|||.:|::||.|:|:.||:..|||||||:.|||:|||.|||:::|||..:
Zfish   237 VGDLPANDPDRKLSLVGSAFWMAPEMLRGEPYDRKVDVFSFGIMLCEILARIPADPEVLPRTKDY 301

  Fly   320 GLDYLAFVEL---CPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEKYE 371
            |||..||.||   ||...    |.|:..||..||..||:|.:...:|..:.|..|
Zfish   302 GLDVQAFRELVQGCPERV----LELSASCCQMDAFRRPSFSELLDELEDIAETLE 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 122/256 (48%)
PKc_like 116..370 CDD:304357 123/260 (47%)
zgc:113162XP_021324511.1 PKc_LIMK_like_unk 96..351 CDD:271058 123/260 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4449767
eggNOG 1 0.900 E2759_2QTCP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46485
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.