DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cdi and Tesk2

Sequence 1:NP_524401.2 Gene:cdi FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_666263.3 Gene:Tesk2 MGIID:2385204 Length:570 Species:Mus musculus

Alignment Length:704 Identity:249/705 (35%)
Similarity:325/705 (46%) Gaps:201/705 (29%)


  Fly    68 GGWIGNGLPPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDFVKEKIGSGFFSEVYKVTHRTT 132
            ||..|:|       .|:...| |:.||.||:.:|.|.|.|:|||.:|||||||||||:||.||.:
Mouse    24 GGGGGDG-------NTVQVGR-VSSSSYRAIISAFSRLTSLDDFTREKIGSGFFSEVFKVRHRAS 80

  Fly   133 GQVMVLKMNQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHALTEYINGGSLEQLLANK 197
            ||||.||||.|.:||.|:|:|:||:|:|||.|||.||||||.:|||||||||||.|:||||| :.
Mouse    81 GQVMALKMNTLSSNRANLLKEMQLMNRLSHPNILRFMGVCVHQGQLHALTEYINSGNLEQLL-DS 144

  Fly   198 EVVLSATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQYEAVVGDFGLAAKIPVKS 262
            ::.|..|.:::||..||.|:||:|..|||||||||||.||:...|. |.|||.|||||.|||..|
Mouse   145 DLYLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENG-YSAVVADFGLAEKIPDAS 208

  Fly   263 -RKSRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLAF 326
             .:.:|..||||:|::||.|:.:.|::.:||||:|||.|||||||:||||.:|||.:|||||.||
Mouse   209 IGREKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEIIARIQADPDYLPRTENFGLDYDAF 273

  Fly   327 VEL---CPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEKYEHESSAGASPLSSLELIN 388
            ..:   ||.|    ||:|.|.||..|.|.||:|.:..|.|..::.:...|               
Mouse   274 QNMVGDCPSD----FLQLTFNCCNMDPKLRPSFEEIGKTLKEIMSRLPEE--------------- 319

  Fly   389 CSPGGSDSENVTLTPRASVPTVATICTAPAGTLTPRHLQEVDEDGFRFPSKKSASAALPGTPNGS 453
                                                   |::.|....|:.|.....:||   |.
Mouse   320 ---------------------------------------ELERDRKLQPTAKGPLEKVPG---GK 342

  Fly   454 AGSSGFDDHILKSRVRRATQKLEAEILLHRRSLSENIIHFPMHTSPSDKARCHQMQRQRSSTHSP 518
            ..|| .||.|                               .|.||..: |...:.|.:|...|.
Mouse   343 RLSS-LDDKI-------------------------------PHKSPRPR-RTIWLSRSQSDIFSH 374

  Fly   519 TPPRQLSSVQLPATSIPDPPPLPKPVPAVLTLRKVGDPQYKPTSEKDHNGSKPNPFEALAQLRGV 583
            .|||.:|                           |.||.|:|.....|. .|.|||.|...|:|.
Mouse   375 KPPRTVS---------------------------VLDPYYQPRDGATHT-PKVNPFSARQDLKGG 411

  Fly   584 K-KILDANPKTYAAGVGDLFSSCFEMLAPFFKELAAMQSKAGAQGGGTSTEETSTGNKASAATPS 647
            | |..|...|:       :.|..|::.||               |.|::|          .|...
Mouse   412 KVKFFDLPSKS-------VISLVFDLDAP---------------GPGSTT----------LADCQ 444

  Fly   648 EP--------KSLPVSP---HMTRKYSAIELRLPQRISNAAPPAVTSAP------PP------SI 689
            ||        :|||.||   |....:...|    :.:|:..||.::|..      ||      |.
Mouse   445 EPLAMSSRRWRSLPGSPEFLHQACPFMGCE----ESLSDGPPPRLSSLKYGVREIPPFRTSALSA 505

  Fly   690 ALPTDEDDCDDCNSEGEDPDGGGNCADAESSSDDSAVRPSTVPTARKYRANSLY 743
            |...:..||    |..::.:|.|......|....:|.....|...|..|| |:|
Mouse   506 ASGHEAMDC----SNPQEENGFGPRLKGTSLCTGAASEEMEVEEERPRRA-SVY 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 151/254 (59%)
PKc_like 116..370 CDD:304357 150/258 (58%)
Tesk2NP_666263.3 TyrKc 62..309 CDD:197581 151/253 (60%)
PKc_TESK 64..316 CDD:271057 150/258 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_2QTCP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3848
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616509
orthoMCL 1 0.900 OOG5_132405
Panther 1 1.100 O PTHR46485
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5384
TreeFam 1 0.960
76.840

Return to query results.
Submit another query.