DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cdi and Tesk1

Sequence 1:NP_524401.2 Gene:cdi FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster
Sequence 2:NP_035701.3 Gene:Tesk1 MGIID:1201675 Length:627 Species:Mus musculus

Alignment Length:739 Identity:259/740 (35%)
Similarity:337/740 (46%) Gaps:185/740 (25%)


  Fly    52 GDATAEAPVKHQPLHNGGWIGNGLPPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDF-VKEK 115
            |....||| ...|...||..|.|.|                ||.||||:|||:|..|||| ..||
Mouse    10 GPGPGEAP-GEGPGGAGGGPGRGRP----------------SSYRALRSAVSSLARVDDFDCAEK 57

  Fly   116 IGSGFFSEVYKVTHRTTGQVMVLKMNQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHA 180
            ||:|||||||||.||.:|||||||||:|.:||.|.||||||:|:|.|.|||.||||||.:|||||
Mouse    58 IGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRSNTLREVQLMNRLRHPNILRFMGVCVHQGQLHA 122

  Fly   181 LTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNLANDQ- 244
            ||||:|||:|||||::.| .||...::.|||.||:|:.|:|..|:|||||||||.|:|.  .|: 
Mouse   123 LTEYMNGGTLEQLLSSPE-PLSWPVRLHLALDIAQGLRYLHAKGVFHRDLTSKNCLVRR--EDRG 184

  Fly   245 YEAVVGDFGLAAKIPV---KSRKSRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARI 306
            :.|||||||||.||||   .:||..|..||||||::||.|:|:.||:.:|||:|||:.||:|||:
Mouse   185 FTAVVGDFGLAEKIPVYREGTRKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARV 249

  Fly   307 EADPDMMPRTASFGLDYLAFVELCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLLEKYE 371
            .||||.:|||..||||..||..|...|.|..||.||.:||..:..:|..|.:.|:.|..:||:..
Mouse   250 PADPDYLPRTEDFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSTRAPFTEITQHLEQILEQQP 314

  Fly   372 HESSAGASPLSSLELINCSPGGSDSENVTLTPRASVPTVATICTAPAGTLTPR---HLQEVDEDG 433
            ..:.....||:...|         :.|....||.          .|:.|| ||   .|.....|.
Mouse   315 EATPLAKPPLTKAPL---------TYNQGSVPRG----------GPSATL-PRPDPRLSRSRSDL 359

  Fly   434 FRFPSKKSASAALPGTPNGSAGSSGFDDHILKSRVRRATQKLEAEILLHRRSLSENIIHFPMHTS 498
            |..||.:|       .|:.....:..:...|:..:|....||               :..|    
Mouse   360 FLPPSPES-------PPSWGDNLTRVNPFSLREDLRGGKIKL---------------LDTP---- 398

  Fly   499 PSDKARCHQMQRQRSSTHSP-TPPRQLSSVQLP-----------------ATSIPDPPPLPKPVP 545
                  |      :.:|..| .||..|:|.|||                 ..|:|..|.||:.:.
Mouse   399 ------C------KPATPLPLVPPSPLTSTQLPLVTTPDILVQPETPVRRCRSLPSSPELPRRME 451

  Fly   546 AVLTLRKVGDPQYKPTSEK-DHNGSKPNPFEALAQLRGVKKILDANPKTYAAGVGDLFSSCFEML 609
            ..|.  ..|.....||.|: |..||.|.|     :..|:     |.....|....:..|:|    
Mouse   452 TALP--GPGPSPMGPTEERMDCEGSSPEP-----EPPGL-----APQLPLAVATDNFISTC---- 500

  Fly   610 APFFKELAAMQSKAGAQGGGTSTEETSTGNKASAATPSEPKSLPVSPHMTRKYSAIELRLPQ--- 671
                                           :||:.|..|:|   .|.:.....|:.:..||   
Mouse   501 -------------------------------SSASQPWSPRS---GPPLNNNPPAVVVNSPQGWA 531

  Fly   672 -----RISNAAPPAVT-----SAPPPSIALPTDEDDCDDCNSEGEDPDGGGNCADAESSSDDSAV 726
                 |..::.|.|..     .:||||  .|.:.::...|          ..|.....|....::
Mouse   532 REPWNRAQHSLPRAAALERTEPSPPPS--APREPEEGLPC----------PGCCLGPFSFGFLSM 584

  Fly   727 RPSTVPTARKYR-----ANSLYAH 745
            .|...|...:||     |.||..|
Mouse   585 CPRPTPAVARYRNLNCEAGSLLCH 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdiNP_524401.2 TyrKc 113..363 CDD:197581 151/254 (59%)
PKc_like 116..370 CDD:304357 152/258 (59%)
Tesk1NP_035701.3 TyrKc 56..306 CDD:197581 151/253 (60%)
PKc_TESK 58..312 CDD:271057 152/257 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_2QTCP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119463at33208
OrthoFinder 1 1.000 FOG0011423
OrthoInspector 1 1.000 T616509
orthoMCL 1 0.900 OOG5_132405
Panther 1 1.100 LDO PTHR46485
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.870

Return to query results.
Submit another query.