DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and YHC1

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_013401.1 Gene:YHC1 SGDID:S000004289 Length:231 Species:Saccharomyces cerevisiae

Alignment Length:51 Identity:22/52 (42%)
Similarity:33/52 (63%) Gaps:4/52 (8%)


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLID 51
            |.:|||:||.:|||||:.||||:|..|:.|......||:    .:|:.:|:
Yeast     1 MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYR----NKARDIIN 47

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 19/37 (51%)
YHC1NP_013401.1 COG5136 1..217 CDD:227465 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S740
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004124
OrthoInspector 1 1.000 T1136297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31148
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1268
TreeFam 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.