DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and AT4G03120

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_567250.1 Gene:AT4G03120 AraportID:AT4G03120 Length:207 Species:Arabidopsis thaliana

Alignment Length:194 Identity:74/195 (38%)
Similarity:88/195 (45%) Gaps:53/195 (27%)


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLID-------ATTAAF- 57
            ||:|||||||||||||||||||.|..|.||:.||:.|||::.|:|.|.|||       ..|..: 
plant     1 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRIYYQQFEEQQTQSLIDQRIKEHLGQTGGYQ 65

  Fly    58 KAGKITNN--------PFAGGPGGAP--------PKPAGVSIPP----PNMGAPPRPGMPGMPYM 102
            :.|.:.|.        |....||..|        |:|   .:||    |..|.|.....||.|..
plant    66 QVGAVFNQHMLARPRPPMMLPPGSMPMGMRPPVLPRP---MMPPQGYMPPPGVPQMMAPPGAPLP 127

  Fly   103 PPLMNPMM---GMRP-------PPIMNPMAMMG-----------PPPPLGTIPGVRP-GIMNGP 144
            ||..|.::   ||.|       ||.|.|:...|           ||||..|.|...| |..|.|
plant   128 PPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPPSGNFNNP 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 28/37 (76%)
AT4G03120NP_567250.1 zf-U1 1..38 CDD:114912 28/37 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2039
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T193307
orthoMCL 1 0.900 OOG5_129565
Panther 1 1.100 LDO PTHR31148
Phylome 1 0.910 0.800 Consistency score
65.960

Return to query results.
Submit another query.