DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and SNRPC

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_003084.1 Gene:SNRPC HGNCID:11157 Length:159 Species:Homo sapiens

Alignment Length:153 Identity:92/154 (60%)
Similarity:106/154 (69%) Gaps:26/154 (17%)


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAGKITNN 65
            |||:|||||||||||||||||||||:||||::|||.|||||||||||.|||.|||||:.|||...
Human     1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPT 65

  Fly    66 PFAGGPGGAPPKPAGVSI-PPPNMGAPPRPGMPGMPYM--PPLMNPMMGMRPPPIMNPMAMMGPP 127
            ||:     ||| |||..| |||::..||||||...|:|  ||:| ||||..||.:|         
Human    66 PFS-----APP-PAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMM-PMMGPPPPGMM--------- 114

  Fly   128 PPLGTIPGVRP------GIMNGP 144
             |:|..||:||      .:|.||
Human   115 -PVGPAPGMRPPMGGHMPMMPGP 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 32/37 (86%)
SNRPCNP_003084.1 zf-U1 1..38 CDD:310663 32/37 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5136
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4044
Isobase 1 0.950 0 Normalized mean entropy S740
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004124
OrthoInspector 1 1.000 T1073927
orthoMCL 1 0.900 OOG5_129565
Panther 1 1.100 LDO PTHR31148
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1268
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.