DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and snrpc

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001016598.1 Gene:snrpc XenbaseID:XB-GENE-495092 Length:159 Species:Xenopus tropicalis

Alignment Length:154 Identity:92/155 (59%)
Similarity:103/155 (66%) Gaps:28/155 (18%)


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAGKITNN 65
            |||:|||||||||||||||||||||:||||::|||.|||||||||||.|||.|||||:.|||...
 Frog     1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPT 65

  Fly    66 PFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMPYMPPLMNPMMGMRPPPIMNPMAMMGPPP-- 128
            |||..|.|:...|     |||:||.||||||  || .||:..|.|          |.||||||  
 Frog    66 PFAAPPAGSAMIP-----PPPSMGGPPRPGM--MP-APPMAGPPM----------MPMMGPPPPG 112

  Fly   129 --PLGTIPGVRP------GIMNGP 144
              |:|..||:||      .:|.||
 Frog   113 MMPVGHGPGMRPPMGAHMPMMPGP 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 32/37 (86%)
snrpcNP_001016598.1 zf-U1 1..38 CDD:114912 32/37 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5136
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3853
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004124
OrthoInspector 1 1.000 T1059988
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1268
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.