DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and zmat5

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_017947412.1 Gene:zmat5 XenbaseID:XB-GENE-984924 Length:214 Species:Xenopus tropicalis

Alignment Length:52 Identity:16/53 (30%)
Similarity:26/53 (49%) Gaps:8/53 (15%)


  Fly     3 KYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKW-------MEEQAQ 47
            :|:|||||... .|:...||.|..|.:|:.:.|.::..:       .|||.:
 Frog     4 RYFCDYCDRSF-QDNLHNRKKHLNGVQHQRSKKAWFDAFRDASEVLAEEQTK 54

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 13/35 (37%)
zmat5XP_017947412.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.