DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and CG31922

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_722687.1 Gene:CG31922 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster

Alignment Length:50 Identity:19/50 (38%)
Similarity:26/50 (52%) Gaps:7/50 (14%)


  Fly     4 YYCDYCDTYLTHDSPSVRKTHCTGRKH---RDNVKFYYQ---KWMEEQAQ 47
            ||||||..:|.:|. :|||.|..|..|   :.|....|:   |.:.|:.|
  Fly     6 YYCDYCCCFLKNDL-NVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQ 54

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 15/37 (41%)
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 15/34 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5136
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.