DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and usp103

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_595384.1 Gene:usp103 PomBaseID:SPBP35G2.09 Length:182 Species:Schizosaccharomyces pombe

Alignment Length:140 Identity:51/141 (36%)
Similarity:66/141 (47%) Gaps:25/141 (18%)


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLID--ATTAAFKAGKIT 63
            ||:|.||||..:|||||.||||.|..||.|..||:.||.|..:|:||..::  |::...|.|   
pombe     1 MPRYLCDYCQVWLTHDSQSVRKAHNAGRAHIQNVQDYYTKVAQEEAQKQLEERASSGFLKKG--- 62

  Fly    64 NNPFAGGPGGAPPKPAGVSIPPP----NMGAPPRPG-MPGMPYMPPL-MNPMMGMRPPPIM---- 118
                    .|:...|...:.||.    |:|.||.|. :....||.|. ||.|......|:|    
pombe    63 --------NGSLDLPYAYAFPPKYNVFNLGCPPPPYIVSANTYMAPKGMNAMNAAAFVPMMPAVN 119

  Fly   119 --NPMAMMGP 126
              |.:|...|
pombe   120 LTNQVAFSAP 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 23/37 (62%)
usp103NP_595384.1 COG5136 1..182 CDD:227465 51/141 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1879
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004124
OrthoInspector 1 1.000 T1125181
orthoMCL 1 0.900 OOG5_129565
Panther 1 1.100 LDO PTHR31148
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1268
TreeFam 1 0.960
77.040

Return to query results.
Submit another query.