DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: snRNP-U1-C and snrpc

Sequence 1:NP_650767.1 Gene:snRNP-U1-C FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_775358.1 Gene:snrpc ZFINID:ZDB-GENE-020419-26 Length:159 Species:Danio rerio

Alignment Length:161 Identity:95/162 (59%)
Similarity:108/162 (67%) Gaps:26/162 (16%)


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAGKITNN 65
            |||:|||||||||||||||||||||:||||::|||.|||||||||||.|||.|||||:.|||...
Zfish     1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPT 65

  Fly    66 PFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMPYM--PPLMNPMMGMRP-------------P 115
            ||.    |||| |.|..:|.|::|.||||||...|.|  ||:| ||||..|             |
Zfish    66 PFP----GAPP-PGGSLLPHPSIGGPPRPGMLPAPPMGGPPMM-PMMGPPPHAMMPGGPGPGMRP 124

  Fly   116 PIMNPMAMM-GP----PPPLGTIPGVRPGIM 141
            |:..||.|| ||    ||....:|.||||::
Zfish   125 PMGGPMQMMPGPHMMRPPARPMMPAVRPGMV 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:114912 32/37 (86%)
snrpcNP_775358.1 zf-U1 1..38 CDD:114912 32/37 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5136
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3997
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004124
OrthoInspector 1 1.000 T1053212
orthoMCL 1 0.900 OOG5_129565
Panther 1 1.100 LDO PTHR31148
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1268
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.