DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31224 and CTCF

DIOPT Version :8

Sequence 1:NP_001287396.1 Gene:CG31224 / 42237 FlyBaseID:FBgn0051224 Length:1784 Species:Drosophila melanogaster
Sequence 2:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster

Alignment Length:662 Identity:145/662 - (21%)
Similarity:242/662 - (36%) Gaps:162/662 - (24%)


  Fly  1139 AKGEISEQESNCDIENS-WSESVYGDISQRYFRNQFSGGYHPDWRQDYYPAQDLSAQLREHKRFD 1202
            |.|....:|:..|:::: .:|....|...:||.:.....|   .:......::|..:|::.....
  Fly    55 AGGSKPMEEAEADLDHAEEAEEEEEDDEDKYFIDDEGNCY---IKTTPKKQKELQKKLKQAAAKP 116

  Fly  1203 FNAVDDEASSSSRRSHLTDLPTAATSSACTSSAMLAGPPIASTSRAAAEAAAEAAALAQRKPQRR 1267
            ..|.....|:::.:| :...|..:|..|.||..  ...|.|.:.|.|..|||:|...|...|   
  Fly   117 GKATRSVVSTATNKS-INLRPAKSTPKATTSKP--PPEPKAISVRPARAAAAKAKQSAMPPP--- 175

  Fly  1268 KLYKCPHCEAIFEKLKERNAHMIGEHNYVRQNRRLICTQPQINTSMLTLQQQMIVQSGEVEDSKD 1332
                    .|:..|:.....         |..:..:..:|:    .:.|::::            
  Fly   176 --------PALVVKVPAPRG---------RPRKNPVIPKPE----PMDLEREL------------ 207

  Fly  1333 GIVKIKQEQCQEKQDVEQMHDHSELLADVKDSELMGIGGDGDGDVDDDIKPPNQLDEKPTLPPLA 1397
                   |:..::.|:      |.::.::.|                     ..:||.......|
  Fly   208 -------EELVDEPDI------SSMVTELSD---------------------YTVDEAAVEAATA 238

  Fly  1398 MTTPAAKLAALYRMLIAYNESKLGQERNNLSELEQKAMEKSIFLCYVCRTDF----PSVKLYDAH 1458
            ..||              ||:::.:..:|.:..::.|.:|.:        ||    ..|||..|.
  Fly   239 TLTP--------------NEAEVYEFEDNATTEDENADKKDV--------DFVLSNKEVKLKTAS 281

  Fly  1459 LTE-------HPAEC----FTCGKKFYRWKNFSLHLKRHLGWKEFGCYVCDKKFVVRSALVEHMR 1512
            .|.       |...|    :|..|||.    .:.|.:.|.....|.|.:|::.|.....|..|:.
  Fly   282 STSQNSNASGHKYSCPHCPYTASKKFL----ITRHSRSHDVEPSFKCSICERSFRSNVGLQNHIN 342

  Fly  1513 MHTGQTPLKCKICGKKFKRYSNLTQH-RKRHTKMMVRKKEYVCHCGEVLPSKARFLWHKETHDLK 1576
            .|.|..|.|||:|...|.....|.:| |.:|||.                              |
  Fly   343 THMGNKPHKCKLCESAFTTSGELVRHTRYKHTKE------------------------------K 377

  Fly  1577 PKCCPYCCDRFVHANSLRRHIRLAHSDKFDYAEPMECPMC----KQIFAKTSIKAHMATHSTEPQ 1637
            |..|..|....|....||||: ..|:.:    .|.:||.|    :.:|   .:|.||..|:.|.:
  Fly   378 PHKCTECTYASVELTKLRRHM-TCHTGE----RPYQCPHCTYASQDMF---KLKRHMVIHTGEKK 434

  Fly  1638 YDCAICSKSFSTKWNLKIHSWVHANRTAKPFKCEYCPKAFVRELDFKNHI-NAHKQIKPYTCEYC 1701
            |.|.||...|:...:||.|..:|:......|:|.|||....|:.|.:.|| :.|....|.||..|
  Fly   435 YQCDICKSRFTQSNSLKAHKLIHSVVDKPVFQCNYCPTTCGRKADLRVHIKHMHTSDVPMTCRRC 499

  Fly  1702 GCKFIRKYNYMRHRREHHGTKKFTCDQCDKSFHRHYYLIEHRRMHTGERPFTCTICGKSSTTKTN 1766
            |.:...:|.|..|.:.|.|.|.::|..|..:.....:|..|..:|..|:||.|..|.::...:..
  Fly   500 GQQLPDRYQYKLHVKSHEGEKCYSCKLCSYASVTQRHLASHMLIHLDEKPFHCDQCPQAFRQRQL 564

  Fly  1767 HNKHLKIHHSRD 1778
            ..:|:.:.|:.:
  Fly   565 LRRHMNLVHNEE 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31224NP_001287396.1 C2H2 Zn finger 1466..1486 CDD:275368 6/23 (26%)
C2H2 Zn finger 1494..1514 CDD:275368 5/19 (26%)
zf-H2C2_2 1506..1531 CDD:290200 10/24 (42%)
C2H2 Zn finger 1522..1542 CDD:275368 7/20 (35%)
PHA00733 1527..1623 CDD:177301 22/100 (22%)
C2H2 Zn finger 1554..1573 CDD:275370 0/18 (0%)
C2H2 Zn finger 1580..1599 CDD:275368 7/18 (39%)
C2H2 Zn finger 1613..1632 CDD:275368 7/22 (32%)
COG5048 <1637..1780 CDD:227381 42/143 (29%)
C2H2 Zn finger 1640..1660 CDD:275368 7/19 (37%)
C2H2 Zn finger 1670..1690 CDD:275368 8/20 (40%)
C2H2 Zn finger 1698..1718 CDD:275368 6/19 (32%)
zf-H2C2_2 1710..1735 CDD:290200 7/24 (29%)
C2H2 Zn finger 1726..1746 CDD:275368 4/19 (21%)
zf-H2C2_2 1738..1763 CDD:290200 8/24 (33%)
C2H2 Zn finger 1754..1774 CDD:275368 3/19 (16%)
CTCFNP_648109.1 23ISL <116..206 CDD:293226 23/116 (20%)
C2H2 Zn finger 296..316 CDD:275368 6/23 (26%)
COG5048 321..>621 CDD:227381 82/294 (28%)
zf-C2H2 322..344 CDD:278523 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
zf-H2C2_2 337..361 CDD:290200 10/23 (43%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 7/20 (35%)
zf-H2C2_2 394..415 CDD:290200 9/25 (36%)
C2H2 Zn finger 409..429 CDD:275368 7/22 (32%)
zf-H2C2_2 422..446 CDD:290200 10/23 (43%)
C2H2 Zn finger 437..457 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..485 CDD:275368 7/17 (41%)
C2H2 Zn finger 496..516 CDD:275370 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 4/19 (21%)
zf-H2C2_2 536..561 CDD:290200 8/24 (33%)
C2H2 Zn finger 552..573 CDD:275368 3/20 (15%)
zf-C2H2 587..609 CDD:278523
C2H2 Zn finger 589..609 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I3687
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.