DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31224 and znf618

DIOPT Version :8

Sequence 1:NP_001287396.1 Gene:CG31224 / 42237 FlyBaseID:FBgn0051224 Length:1784 Species:Drosophila melanogaster
Sequence 2:NP_001313621.1 Gene:znf618 / 100330008 ZFINID:ZDB-GENE-030131-2063 Length:827 Species:Danio rerio

Alignment Length:274 Identity:58/274 - (21%)
Similarity:84/274 - (30%) Gaps:106/274 - (38%)


  Fly  1466 CFTCGKKFYRWKNFSLHLKRH-------------LGWKEFGCYVCDKKFVVRSALVEHMRMHTGQ 1517
            |..||||:..:..|..|::.|             ||......|.||                   
Zfish    83 CGVCGKKYKYYNCFQTHVRAHSEAEGTVSGEGASLGINSAFRYTCD------------------- 128

  Fly  1518 TPLKCKICGKKFKRYSNLTQHRKRHTKMMVRKKEYVCHCGEVLPSKARFLWHKETHDLK------ 1576
                  :||||:|.||...:||..|..    ...|    ..|:|          ..|||      
Zfish   129 ------VCGKKYKYYSCFQEHRDLHAV----DDPY----DHVIP----------VEDLKEEAESF 169

  Fly  1577 ----PK----CCPYCCDRFVHANSLRRHIRLAHSDKFDYAEPMECPMCKQIFAKTSIKAHMATHS 1633
                ||    .|.||..::.:.|..:.|:.|....|..:...:|..:..|....:.:..:.:.:|
Zfish   170 QKMGPKTGSYTCEYCGKQYKYFNPYQEHVALHAPLKGTFGLKLEGKLSGQSGQSSRVDINNSHNS 234

  Fly  1634 TE------------PQ--YDCAICSKSFSTKWNLKIHSWVHANRTAKPFKCEYCPKAFVRELDFK 1684
            ::            ||  |.|..|...|....||..|...||                   .|.:
Zfish   235 SDTPNSRTYTSLPSPQKTYTCGACGIQFQFYNNLLEHMQSHA-------------------ADNE 280

  Fly  1685 NHINAHKQIKPYTC 1698
            ||:   |:..|..|
Zfish   281 NHV---KEDSPKPC 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31224NP_001287396.1 C2H2 Zn finger 1466..1486 CDD:275368 7/19 (37%)
C2H2 Zn finger 1494..1514 CDD:275368 3/19 (16%)
zf-H2C2_2 1506..1531 CDD:290200 4/24 (17%)
C2H2 Zn finger 1522..1542 CDD:275368 9/19 (47%)
PHA00733 1527..1623 CDD:177301 25/109 (23%)
C2H2 Zn finger 1554..1573 CDD:275370 2/18 (11%)
C2H2 Zn finger 1580..1599 CDD:275368 5/18 (28%)
C2H2 Zn finger 1613..1632 CDD:275368 1/18 (6%)
COG5048 <1637..1780 CDD:227381 16/64 (25%)
C2H2 Zn finger 1640..1660 CDD:275368 6/19 (32%)
C2H2 Zn finger 1670..1690 CDD:275368 3/19 (16%)
C2H2 Zn finger 1698..1718 CDD:275368 1/1 (100%)
zf-H2C2_2 1710..1735 CDD:290200
C2H2 Zn finger 1726..1746 CDD:275368
zf-H2C2_2 1738..1763 CDD:290200
C2H2 Zn finger 1754..1774 CDD:275368
znf618NP_001313621.1 C2H2 Zn finger 83..103 CDD:275368 7/19 (37%)
C2H2 Zn finger 127..147 CDD:275368 11/44 (25%)
Dimer_Tnp_hAT 746..>788 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24383
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.