DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14301 and ckd

DIOPT Version :8

Sequence 1:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_647796.2 Gene:ckd / 38402 FlyBaseID:FBgn0035427 Length:140 Species:Drosophila melanogaster

Alignment Length:72 Identity:29/73 (40%)
Similarity:41/73 (56%) Gaps:1/73 (1%)


  Fly   101 NFYCDEQEYPGFFADMETRCQGWHYCDIDGRQATFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLY 165
            :|.|..:.. ||:||||..||.:|.||.:|.:...||.|.|.|:|...:|||.:|..|..||:.:
  Fly    58 SFDCKRRSV-GFYADMEYNCQIFHMCDEEGNRIPHLCANETSFNQEYRICDWDYNFNCTESPKWF 121

  Fly   166 AINARLY 172
            .:|...|
  Fly   122 YLNELTY 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 23/52 (44%)
ckdNP_647796.2 CBM_14 61..111 CDD:279884 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.