DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and PTK1

DIOPT Version :8

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_012723.3 Gene:PTK1 / 853635 SGDID:S000001681 Length:662 Species:Saccharomyces cerevisiae

Alignment Length:287 Identity:75/288 (26%)
Similarity:114/288 (40%) Gaps:82/288 (28%)


  Fly    74 KFFPR---ELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENG----------DLLSHIKRSGP 125
            ||:.|   |..|..::.|...|....:|.:.|...    |...|          ||.:.|::|| 
Yeast   238 KFYKRCSKEFIIAKQLSHHVHITNTFLLVKVPTTV----YTTRGWGFVMELGLRDLFAMIQKSG- 297

  Fly   126 IDEKQSKIW-----------FFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYC 179
                    |           |.|::..:|:.|:..|||||||.||:|||.....||.|||.:.:.
Yeast   298 --------WRSVALAEKFCIFKQVACGVKFCHDQGIAHRDLKPENVLLSPDGVCKLTDFGISDWY 354

  Fly   180 RDD----NGREMKSETYCGSAAYAAPEVV-----------CGRPYDPKLADAWSLGVILFIMMNA 229
            ..|    :....|.....||..||.|||:           ..:||||:..|.:.||:||..::|.
Yeast   355 HTDPHDLSSPVKKCAGMIGSPPYAPPEVMFYDSKKHYDTELQQPYDPRALDCYGLGIILMTLVNN 419

  Fly   230 KMPFDDS---------------NLTKLLEDQ--RNR---------KFAFRRKLQETISAQAKATV 268
            .:||.:|               |..: |.|:  |||         ::...|..:   :..|....
Yeast   420 VIPFLESCSFDTGFRDYCDAYENFIR-LHDRAFRNRGNYRPGPGMEYHLARNFK---NGHASRVA 480

  Fly   269 SVLLEPEAHARWNLREILNCAWLRTVE 295
            ..|.:|||..|:.:.::....|.:.:|
Yeast   481 WRLADPEAATRYTIDDLFEDPWFQGIE 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 74/282 (26%)
S_TKc 28..287 CDD:214567 73/278 (26%)
PTK1NP_012723.3 S_TKc 200..503 CDD:214567 74/282 (26%)
PKc_like 202..503 CDD:304357 74/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112712373
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.