DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and C27D6.11

DIOPT Version :8

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001021995.1 Gene:C27D6.11 / 3564833 WormBaseID:WBGene00044388 Length:334 Species:Caenorhabditis elegans

Alignment Length:286 Identity:106/287 (37%)
Similarity:150/287 (52%) Gaps:24/287 (8%)


  Fly    32 HK------IGEGSYATVITAGYADDHGHGVHLACKIID--KAKAPTDFVNKFFPRELEILTKIDH 88
            ||      :|.|||:.|..|.:.|..   :.:|.|:|:  ..:...|::.||.|||.||:..:.|
 Worm    37 HKLKFDKILGSGSYSRVARATWGDKK---LEVAAKVINITSTREKDDYIKKFLPREKEIVKLLKH 98

  Fly    89 SNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHR 153
            .||.:::.::.....|.....:...||||..:|....::|..:|..|.|...||.:|.:.:|.||
 Worm    99 DNICRLYEMISFPDHIIFVTEFCAGGDLLRKMKDIKTMNEDDAKFTFRQFIAALMHLQSYNIVHR 163

  Fly   154 DLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWS 218
            |||||||.|.|..|:||.||||:|..:...    ||.|:|||.||.|||::.||.|.....|.||
 Worm   164 DLKCENIFLDKHENVKLGDFGFSRILKPGE----KSGTFCGSRAYVAPEILRGREYSGNAVDVWS 224

  Fly   219 LGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWNLR 283
            .||||:||:...|||||.|.||::|.|...|..|.:..  |.|.|:||.:..:|:|.|..|...:
 Worm   225 TGVILYIMLVGSMPFDDRNPTKMIERQLAHKIKFPKLC--TASVQSKALILEILQPHAPNRPTYK 287

  Fly   284 EILNCAWLRTV-------EESQTPIP 302
            .|....||::.       |..:.|.|
 Worm   288 AICESEWLKSQPYYMKPDEHPKLPTP 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 102/267 (38%)
S_TKc 28..287 CDD:214567 101/263 (38%)
C27D6.11NP_001021995.1 S_TKc 40..295 CDD:214567 100/264 (38%)
PKc_like 41..295 CDD:304357 100/263 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112718936
eggNOG 1 0.900 E33208_3BHY0
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H56448
Inparanoid 1 1.050 181 1.000 Inparanoid score I2611
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D403296at33208
OrthoFinder 1 1.000 FOG0000885
OrthoInspector 1 1.000 T98041
orthoMCL 1 0.900 OOG5_131212
Panther 1 1.100 O PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5387
TreeFam 1 0.960
1110.880

Return to query results.
Submit another query.