DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and Grip1

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_006514294.1 Gene:Grip1 MGIID:1921303 Length:1185 Species:Mus musculus

Alignment Length:973 Identity:198/974 (20%)
Similarity:324/974 (33%) Gaps:345/974 (35%)


  Fly     6 EWSQVEVIDLI-NDGNGLGFILVGG--RSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRG 67
            |:....|::|: .:|..||..:.||  :.....:..|..||:|.|..:|.:||::..:..:||..
Mouse   104 EFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAK 168

  Fly    68 FSSEQVATVLRQTGAQVRLIVARPVEPTAID-----YQTLACQAPIIPTKLLSDPEELSRHLFQN 127
            |..:::.::|:..|.:|.|.|...:.|.::.     ::|:                |::.|    
Mouse   169 FRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTV----------------EVTLH---- 213

  Fly   128 PSFATAAVAAAAAAAAAAGSGSDGDVGG----GGVLDVAS-----LVGLVR-GGPA--EGTELSA 180
                                 .:|:..|    ||..|..:     ::..|| ||||  |||    
Mouse   214 ---------------------KEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGT---- 253

  Fly   181 VEPQPSAAVLQLQQLSELAGDLADFPLPPIPGGGGHSMVTDSNAGQRPCPRLDLDIVPFSILSPP 245
            ::|                ||                             || |.:....:|...
Mouse   254 IKP----------------GD-----------------------------RL-LSVDGIRLLGTT 272

  Fly   246 PRPALQMLPLETQWRCVQDQNRHIETVIADSKRKLLANEDGGSASASGSGSPDSYMDSPETET-- 308
            ...|:.:|.     :|.|:....||..:                         |.|||..|.:  
Mouse   273 HAEAMSILK-----QCGQEATLLIEYDV-------------------------SVMDSVATASGP 307

  Fly   309 YVVELHKNV-YGLGITVAGYVCEEEDLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVT 372
            .:||:.|.. ..||:.:...||..:.:  |.:..|...|.|:..|.:.:.|.|:::||.|:...|
Mouse   308 LLVEVAKTPGASLGVALTTSVCCNKQV--IVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCT 370

  Fly   373 NHQAVELLRNT------DIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQES 431
            ..:|.:.|.||      :|:.|......|:|.  :|:::..:           ||....|....:
Mouse   371 LAEATQFLANTTDQVKLEILPHHQTRLALKGP--DHVKIQRS-----------DRQHPWDAWASN 422

  Fly   432 QLSM----------PGSPSIATLSW---LPPKSLDADSIATEGDEAVDAEYVGISGAEDEFIELP 483
            |..:          |....:..|::   |||.|..|                             
Mouse   423 QCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPPA----------------------------- 458

  Fly   484 SRDTVESNMSHVLDRSDHSGGLTKDQVPRISP-------IVPLTNG---RSLILADDSGNDTDEQ 538
                                     .||..||       :..|..|   |||......|      
Mouse   459 -------------------------MVPSSSPTSMSAYSLSSLNMGTLPRSLYSTSPRG------ 492

  Fly   539 CAEPETETAQARKGSKPETERVKDLGDTKTDTDPDPDLDPGQ-MPTPTNEAPVKAASPTAASLRV 602
                   |...|:..|.:.:....|..:....       .|| :.|.|.|. |..|.|..     
Mouse   493 -------TMMRRRLKKKDFKSSLSLASSTVGL-------AGQVVHTETTEV-VLTADPVT----- 537

  Fly   603 AWKSLGISLEGTVDVECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVN---------EHKL 658
               ..||.|:|:|.....:...|  .|..|.||.|..|.|:|:.||.::.:|         |...
Mouse   538 ---GFGIQLQGSVFATETLSSPP--LISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEAN 597

  Fly   659 QGLRHIEVV-KILKELPARVKLVCARGTHVPSVINTSQNPEAFETRSLLPGGHQSLQNLLSKAQS 722
            |.||...:. |:..|:...|         ..|||.:|   ..|..:  ||..|.  ..|.....|
Mouse   598 QLLRDSSITSKVTLEIEFDV---------AESVIPSS---GTFHVK--LPKKHS--VELGITISS 646

  Fly   723 ESSLYTSSTATLTD--AGAAAGGSGGTAGGGARSKSLENV---------SGLALWSCE------- 769
            .||........::|  .|:.|..: ||...|.:..:::|:         :...|..||       
Mouse   647 PSSRKPGDPLVISDIKKGSVAHRT-GTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKI 710

  Fly   770 ----------------VTAVDIEKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIY 818
                            :..|::::.....|.:|...::|.|.    |:|..|.:||.||.|..|:
Mouse   711 RKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEPFDP----IIISSLTKGGLAERTGAIH 771

  Fly   819 PGDRLMSVGDRLLQGLELDEAVSILKAMPPGLTRLGICRPLSASDSNSNSNIASP-----LGD 876
            .|||::::....|:|..|.||:.:|:.....:| |.|.:...|..::|......|     |||
Mouse   772 IGDRILAINSSSLKGKPLSEAIHLLQMAGETVT-LKIKKQTDAQSASSPKKFPIPGHSGDLGD 833

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 21/74 (28%)
PDZ 307..393 CDD:214570 24/95 (25%)
PDZ_signaling 605..680 CDD:238492 24/85 (28%)
PDZ 773..858 CDD:214570 26/85 (31%)
Grip1XP_006514294.1 PDZ_signaling 110..190 CDD:238492 23/80 (29%)
PDZ_signaling 209..292 CDD:238492 28/163 (17%)
PDZ_signaling 307..390 CDD:238492 23/85 (27%)
PDZ_signaling 526..614 CDD:238492 28/99 (28%)
PDZ_signaling 627..711 CDD:238492 18/89 (20%)
PDZ_signaling 727..808 CDD:238492 26/86 (30%)
PDZ_signaling 1058..1138 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.