DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and Ush1c

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_710143.2 Gene:Ush1c MGIID:1919338 Length:910 Species:Mus musculus

Alignment Length:812 Identity:159/813 (20%)
Similarity:245/813 (30%) Gaps:280/813 (34%)


  Fly    21 GLGFILVGGR--STGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLR---QT 80
            |||..:.||.  ..|:.|..|..||.|:..| ||:||.:::|...::...:.|:|..::|   ..
Mouse    97 GLGLSVRGGLEFGCGLFISHLIKGGQADSVG-LQVGDEIVRINGYSISSCTHEEVINLIRTKKTV 160

  Fly    81 GAQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDPEELSRHLFQNPSFATAAVAAAAAAAAAA 145
            ..:||.|                   .:||.|  |.|||..:..:.:.       ..:.:.....
Mouse   161 SIKVRHI-------------------GLIPVK--SSPEESLKWQYVDQ-------FVSESGGVRG 197

  Fly   146 GSGSDGDVGGGGVLDVASLVG------LVRGGPAE--GTELSAVEPQPSAAVLQLQ---QLSELA 199
            |.||.|:..........||||      .:..||.:  |..:|.|:|...:|.:.|:   |:.|:.
Mouse   198 GLGSPGNRTTKEKKVFISLVGSRGLGCSISSGPIQKPGIFVSHVKPGSLSAEVGLETGDQIVEVN 262

  Fly   200 GDLADF------------------PLPPIPGGGGHSMVTD----SNAGQRPCPRLDLDIVPFSIL 242
            |  .||                  .:..:.|.|....:||    ..|.||...|.:| ::...:.
Mouse   263 G--IDFTNLDHKEAVNVLKSSRSLTISIVAGAGRELFMTDRERLEEARQRELQRQEL-LMQKRLA 324

  Fly   243 SPPPRPALQMLPLETQWR------CVQDQNRH---IETVIADSKR-KLLANEDGGSASASGSGSP 297
            ....:...:...:|.|.|      ..::..|:   :|.:..:.:: |....||.||         
Mouse   325 MESNKILQEQQEMERQRRKEIAQKAAEENERYRKEMEQISEEEEKFKKQWKEDWGS--------- 380

  Fly   298 DSYMDSPETETYVV----------------------------------------ELHKNVYGLGI 322
            ...:..|:|.|..|                                        :|.||...|..
Mouse   381 KEQLILPKTITAEVHPVPLRKPKSFGWFYRYDGKFPTIRKKAKEKKKAKYDSLQDLRKNKKELEF 445

  Fly   323 TVAGYVCEEEDLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVELLRNTDIVV 387
            ....|..:||.|              |...|::||.....|      ..|..:.:|....|...|
Mouse   446 EQKLYKEKEEML--------------EKEKQLKINRLAQEV------SETEREDLEESEKTQYWV 490

  Fly   388 HLTLERFLRGRKYEHLQVALTEI-KGTSAPSGLDRSQDKDQDQESQLSMPGSPSIATLSWLPPKS 451
                ||..:.| .|.:..|..|| :.|:.|.                  |..||::.|:  ||..
Mouse   491 ----ERLCQTR-LEQISSAENEIPEMTTGPP------------------PPPPSVSPLA--PPLR 530

  Fly   452 LDADSIATEGDEAVDAEYVGISGAEDEFIELPSRDTVESNMSH--------------VLDRSDHS 502
            ..|..|.....:..|...       |.|...|...:....|.|              ||..|.|.
Mouse   531 RFAGGIHLHTTDLDDIPL-------DMFYYPPKTPSALPVMPHPPSVNPPSKVPAPPVLPSSGHV 588

  Fly   503 GGLTKDQVPRISPIVPLTNGRSLILAD-----------------------DSGNDTDEQCAEPET 544
            ...:...|.|..|.:|:....|:...|                       |.|:..|:.    |.
Mouse   589 SSSSSPWVQRTPPPIPIPPPPSIPTQDLTPTRPLPSALEEALGNHPFRTGDPGHPADDW----EA 649

  Fly   545 ETAQARKGSKPETERVKDLGDTKTDTDPDPDLDPG-----------------QMPTPTNE----- 587
            .|...:..|.|.|||............|.|...||                 ..|...:|     
Mouse   650 NTHSGKPSSSPTTERSFPPAPKTFCPSPQPPRGPGVSTISKPVMVHQEHNFVYRPAVKSEVLPQE 714

  Fly   588 -----------------------------APVKAASPTAASLRVAWK-SLGISLEGTVDVECGIE 622
                                         :|.:.|......||:..: ||.::|||.||...|  
Mouse   715 MLKRMVVYQTAFRQDFRKYEEGFDPYSMFSPEQIAGKDVRLLRIKKEGSLDLALEGGVDSPVG-- 777

  Fly   623 KRPHHYIRSILADGPVGRQGILRPGDELLQVN 654
               ...:.::...|...|.|.:..|||::.:|
Mouse   778 ---KVVVSAVYEGGAAERHGGVVKGDEIMAIN 806

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 23/73 (32%)
PDZ 307..393 CDD:214570 20/126 (16%)
PDZ_signaling 605..680 CDD:238492 15/52 (29%)
PDZ 773..858 CDD:214570
Ush1cNP_710143.2 N-terminal domain. {ECO:0000250|UniProtKB:Q9Y6N9} 1..86
harmonin_N 2..80 CDD:259819
PDZ_signaling 85..165 CDD:238492 21/69 (30%)
Mediates interaction with MYO7B. {ECO:0000250|UniProtKB:Q9Y6N9} 194..833 129/687 (19%)
PDZ_signaling 209..289 CDD:238492 17/82 (21%)
Cgr1 <309..>358 CDD:281823 8/50 (16%)
PDZ_signaling 751..838 CDD:238492 17/62 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.