DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and Pdzd2

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_075229.1 Gene:Pdzd2 RGDID:619958 Length:2766 Species:Rattus norvegicus

Alignment Length:911 Identity:172/912 (19%)
Similarity:296/912 (32%) Gaps:304/912 (33%)


  Fly    36 IKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQ--TGAQVRLIVARPVEPTAID 98
            :..|.....|.:.|:::|.|.:|.:....:.|......:.:..|  .|..:.||:.|..:..|  
  Rat   121 VTELRKNSPAGKSGKVRLRDEILSLNGQLMVGVDVTGASYLAEQCWNGGFIYLIMLRRFKQKA-- 183

  Fly    99 YQTLACQAPIIPTKLLSDPEELSRHLFQNPSFATAAVAAAAAAAAAAGSGSDGDVGGGGVLDVAS 163
                                    |:..|                 ..||:..:.|....|:   
  Rat   184 ------------------------HVTYN-----------------GNSGNSSEPGETPTLE--- 204

  Fly   164 LVGLVRGGPAEGTELSAVEPQPSAAVLQLQQLSELAGDLADFPLPPIPG------GGGHSMVTDS 222
             :|.......:.|....|..:||.:.......|....|.||.|...:..      |.||:     
  Rat   205 -LGDQTSKKGKRTRKFGVISRPSISKTPEDSKSSSGCDTADDPNSELENGADPELGNGHA----- 263

  Fly   223 NAGQRPCPRLDLDIVPFSILSPPPRPALQMLPLETQWRCVQDQNRHIETVIADSKRKLLANEDGG 287
                     .:|:..|.| |.....|.|:....:::   |:.:....|..::||..|...::.| 
  Rat   264 ---------FELENGPHS-LKDVAGPHLERSEADSE---VELRVPKTEAPLSDSNDKRRFSKTG- 314

  Fly   288 SASASGSGSPDSYMDSPETETYVVELHKNVYGLGITVAGYVCEEEDLSGIFVKSIIEGSAAETSG 352
               .:...|.|..........:.:||.|...||||.|:|....:.....|.|..:.||.||...|
  Rat   315 ---KTDFQSSDCLAREEVGRIWKMELLKESDGLGIQVSGGRGSKRSPHAIVVTQVKEGGAAHRDG 376

  Fly   353 QIQINDRIVAVDGRSLSGVTNHQAVELLRNTDIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPS 417
            ::.:.|.::.::|..|.|:::.:||.:||:...:|.|.:                     .|...
  Rat   377 RLSLGDELLVINGHLLVGLSHEEAVAILRSATGMVQLVV---------------------ASKMP 420

  Fly   418 GLDRSQDKDQDQESQLSMPGSPSIATLSWLPPKSLDADSIATEGDEAVDAEYVGISGAEDEFIEL 482
            |.:.|||....:||                            :|:                 :|.
  Rat   421 GSEESQDVGSSEES----------------------------KGN-----------------LES 440

  Fly   483 PSRDTVESNMSHVLDRSDHSGG-------------LTKDQVPRISPIVPLTNGR--SL-ILADDS 531
            |.:...::.:     :|..|||             :.::..|||..:....:||  || .|.|.:
  Rat   441 PKQGNCKTKL-----KSRLSGGVHRLESVEEYNELMVRNGDPRIRMLEVSRDGRKHSLPQLLDST 500

  Fly   532 GNDTDEQCAEPETETAQARKGSKPETERVKDLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPT 596
            |...:....:..|.:                                  :.|...|:|.:...|:
  Rat   501 GTSQEYHIVKKSTRS----------------------------------LSTTHVESPWRLIRPS 531

  Fly   597 AASL----RVAWKSLGISLEGTVDV---ECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVN 654
            ..|:    :...|.||.|:.|..|.   :.||      ::::|..:|.....|.|:.|||:|.||
  Rat   532 VISIIGLYKEKGKGLGFSIAGGRDCIRGQMGI------FVKTIFPNGSAAEDGRLKEGDEILDVN 590

  Fly   655 EHKLQGLRHIEVVKILKE-------LPARVKLV------CARGTHVPSVINTSQNPEAFETRSLL 706
            ...::||...|.:...|:       |..|.||:      |:..||:              :||  
  Rat   591 GIPIKGLTFQEAIHTFKQIRSGLFVLTVRTKLLSPSLTPCSTPTHM--------------SRS-- 639

  Fly   707 PGGHQSLQNLLSKAQSESSLYTSSTATLTDAGAAAGGSG--GTAGGGARSKSLENVS-------G 762
                           |..|..|:|..|....|...|||.  |....|.:.:.:..|:       |
  Rat   640 ---------------SSPSFNTNSGGTPAGGGQEEGGSSSLGRKAPGPKDRIVMEVTLNKEPRVG 689

  Fly   763 LALWSCEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMSVG 827
            |.:.:|   .:.:|.:..|                  |.|..|..|..|:..:.:..||:::.|.
  Rat   690 LGIGAC---CLALENSPPG------------------IYIHSLAPGSVAKMESNLSRGDQILEVN 733

  Fly   828 DRLLQGLELDEAVSILKAMPPGLTRLGICRP-------------------LSASDSNSNSNIASP 873
            ...::...|.:..:||...|||..||.|.|.                   ..:.::||:..:.:|
  Rat   734 SVNVRHAALSKVHAILSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESREANSSPGLGTP 798

  Fly   874 L 874
            |
  Rat   799 L 799

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 11/55 (20%)
PDZ 307..393 CDD:214570 26/86 (30%)
PDZ_signaling 605..680 CDD:238492 26/85 (31%)
PDZ 773..858 CDD:214570 20/85 (24%)
Pdzd2NP_075229.1 PDZ_signaling 335..416 CDD:238492 26/102 (25%)
PDZ_signaling 538..619 CDD:238492 23/87 (26%)
PDZ_signaling 677..761 CDD:238492 22/105 (21%)
PHA03193 <1180..1349 CDD:177555
PDZ_signaling 2551..2625 CDD:238492
PDZ_signaling 2679..2761 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.