DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and dlg5a

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_005156738.1 Gene:dlg5a ZFINID:ZDB-GENE-030131-3149 Length:1961 Species:Danio rerio

Alignment Length:1063 Identity:209/1064 (20%)
Similarity:342/1064 (32%) Gaps:351/1064 (33%)


  Fly     4 STEWSQVEVIDLINDGN-----GLGFILVGG-------RSTGVVIKALTPGGVAERDGRLQLGDH 56
            |.|| :.||::...|.:     .:||.:..|       ...|:.:..:..|.:|  ||||::.|.
Zfish   689 SLEW-ETEVVEFEKDRDDMDLKAMGFDIAEGVNDPYLPGDCGIFVSRVDKGSIA--DGRLRVNDW 750

  Fly    57 LLQIGEVNLRGFSSEQVATVLRQTGAQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDPEELS 121
            ||:|.:|:|.....:||...:...|..:.::|.|                    .|.|......|
Zfish   751 LLKINDVDLTNKDRKQVIKAVLNGGGLINMVVRR--------------------RKSLGGRLVTS 795

  Fly   122 RHL----FQNPSFATAA---VAAAAAAAAAAGSGS----DGDVGGGGV-LDVASL---VGLVRGG 171
            .|:    .::...|...   ||..|..:.||..||    |..:...|: ||..||   ..|:|||
Zfish   796 VHINLIGHKDAGIALEGGVFVAGIAPGSPAAREGSLTIGDRLIAINGIALDNKSLSECEALLRGG 860

  Fly   172 PAEGTELSAVE--PQPSAAVLQLQQLSELAGDLADFPLPPIPGGGGHSMVTDSN----------A 224
             .:...||.::  ||.::.....:.|.|.........|..:......::..:|:          |
Zfish   861 -RDSLALSLMKFFPQSTSGQNIFESLREAEKSNGRIHLTDVHSRNSRNLKHNSSTQTDIYSCDTA 924

  Fly   225 GQRPCPRLDLD--------IVPFSILSPPP-RPALQMLPLE-----------TQWRCVQDQNRHI 269
            |:|...|.|.:        :.|.|.|.|.. |||.::.|:.           |:...|..:...:
Zfish   925 GERRKTRSDAEESLFSERKVFPISTLHPNTLRPASELGPVRYSASAFQEVCYTRSESVGPECVTL 989

  Fly   270 ETVI-------------------ADS-----------KRKLLANED-------------GGSASA 291
            ||.:                   .||           :||.:.:.|             .|....
Zfish   990 ETTLEKKHSGGTWPKMVVGVAMTTDSPAQLSIYRSPKQRKSIFDADTFKRPDTPSKADYHGPQPL 1054

  Fly   292 SGSGSPDSYMDSPETETYVVELHKNVYGLGITVAGYVCEEEDLSGIFVKSIIEGSAAETSGQIQI 356
            ....:|........::::..: ||:        .|....|..:|.:   ||.|....:.:|.:..
Zfish  1055 KADSAPTPPTPPTRSDSFKFK-HKH--------QGSSTSESTISAM---SISEPKQEDRNGNLYF 1107

  Fly   357 NDRIVAVDGRSLSGVTNHQAVELLRNTDIVVHLTLERFLRGRKY-EHLQVALTEIKGTSAPSGLD 420
            :      :|:.||   :.::.|    .||           ||.: |..:|.....|  |||:...
Zfish  1108 S------EGKVLS---SRKSCE----EDI-----------GRMWAEEPEVKRPRPK--SAPALRR 1146

  Fly   421 R--------------SQDKDQDQESQL--SMPGSPSIATLSW--------LPPKSLDADSIATEG 461
            |              |.|.|..::.::  |.|..|...::.:        |||.|..........
Zfish  1147 RMTPQNIPLQSFQSYSNDGDSVEQREMLRSSPNRPHRHSVGFVPTSYNGTLPPNSAHRGLAPCSA 1211

  Fly   462 DEAVDAEYVGISGAEDEFIELPSRDTVES--NMSHVLDRSDHSGGLTKD---------------- 508
            ..||....|.:  .....:...:..||.|  |..|......|.|.|:.|                
Zfish  1212 VTAVMKNPVYM--VRSHRVHTNNCPTVVSQINQQHTHPSPQHQGQLSLDLSQKRSTDYSESSRSS 1274

  Fly   509 -----------------------QVPRISPIVPLT--NGRSLILADDSGNDTDEQCAEP------ 542
                                   :..||.  :|.|  ..|| ||..|.|:.:..:|:.|      
Zfish  1275 RASHGTNSLPSSARLGSSNNLQYRTERIK--IPSTPRYPRS-ILGSDRGSLSHSECSSPSLITPP 1336

  Fly   543 ------ETET--AQARKGS-----------KPETERVKDLGDTKTDTDPDPDLDPGQMPTPTNEA 588
                  ||.:  :...:||           .|..||.||          .|.|:     .|.|..
Zfish  1337 LSPLNLETSSFASSQSQGSISTLPRISVSPVPTEERRKD----------RPYLE-----EPRNVM 1386

  Fly   589 PVKAASPTAASLRVAWKSLGISL----EGTVDVECGIEKRPHHYIRSILADGPVGRQGILRPGDE 649
            ..|.|.|           ||||:    .|.:.|             |.:..|.:..|..|..||:
Zfish  1387 VHKGAEP-----------LGISIVSGENGGIFV-------------SKVTGGSIAHQAGLEYGDQ 1427

  Fly   650 LLQVNEHKLQGLRHIEVVKILKELPARVKLVCARGTHVPSVINTSQNPEAFE---TRS------- 704
            ||:.|...|:.....:...|:.:....:.::.....|:..:.|.|::....|   |:|       
Zfish  1428 LLEYNGINLRNATEQQARLIIGQQCDTITIMAQYNPHMYQLGNHSRSSSRLEPVSTQSTPQGSGT 1492

  Fly   705 LLPGGHQSLQNLLSKAQSESSLYTSSTATLTDAGAAAGGSGGTAGGGA----RSKSLENVSGLAL 765
            ..|..|.::..|  ..|.|.:|..||..|..           |....:    .|:|.:.|.    
Zfish  1493 ATPDNHSTIDTL--SEQDEGTLTPSSKQTTP-----------TTSPNSFIRMPSESSKKVP---- 1540

  Fly   766 WSCEVTAVDIEKTEQGFGFSILDYQDPLDSEGSV--IVIRGLIRGGAAEATNEIYPGDRLMSVGD 828
               |...|.:.||:...|..:..        |::  |.:..|.....|...:.:.|||.::..|.
Zfish  1541 ---EARLVTVRKTQVELGIQLCG--------GNLRGIFVERLEDDSPARGADAVVPGDMILEYGS 1594

  Fly   829 RLLQGLELDEAVSILKAMPPGLT 851
            ..::...::||  .|:.:.|..|
Zfish  1595 VNMKNKTVEEA--YLEMLKPAET 1615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 21/84 (25%)
PDZ 307..393 CDD:214570 15/86 (17%)
PDZ_signaling 605..680 CDD:238492 17/79 (22%)
PDZ 773..858 CDD:214570 17/82 (21%)
dlg5aXP_005156738.1 CARD 9..88 CDD:260018
Takusan 128..211 CDD:282652
Taxilin 295..627 CDD:286771
RILP-like 338..460 CDD:304877
SH3BP5 444..648 CDD:283045
PDZ_signaling 696..783 CDD:238492 22/89 (25%)
PDZ_signaling 793..866 CDD:238492 20/74 (27%)
PDZ 1381..1463 CDD:214570 22/106 (21%)
dbPDZ_assoc 1461..1541 CDD:293216 19/100 (19%)
PDZ 1541..1623 CDD:214570 18/86 (21%)
SH3_DLG5 1639..1701 CDD:212794
Guanylate_kin 1780..1949 CDD:279019
NK 1794..1950 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.