DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and Grasp

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_062391.3 Gene:Grasp MGIID:1860303 Length:392 Species:Mus musculus

Alignment Length:429 Identity:96/430 (22%)
Similarity:146/430 (34%) Gaps:122/430 (28%)


  Fly   191 QLQQLSELAGDLADFPLPPIPGGGGHSMVTDSNAGQ-RPCPRLDLDIVPFSILSPPPRPALQMLP 254
            :|||..|...       .|.|.|    ...||.|.: .|.|.           .||...|....|
Mouse     8 KLQQKEEATA-------APDPAG----RAPDSEAARAAPLPS-----------GPPAAAAPPGAP 50

  Fly   255 LETQWRCVQDQNRHIETVIADSKRKLLANEDGGS-ASASGSGSP-DSYMDSPETETYVVELHK-- 315
            .|..:..::|.:.      |:..|.|..:  ||: ....|||.. .::..|||.:..|:.|.|  
Mouse    51 GEELYAALEDYHP------AELYRALAVS--GGTLPRRKGSGFRWKNFTQSPEQQRKVLTLEKGD 107

  Fly   316 -NVYGLGITVAGYVCEEEDLSGI--FVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAV 377
             ..:|..|...|....||....:  ||..:.|.|.|:.:| :...|.|.:|:|.::.|:.:.:.|
Mouse   108 NQTFGFEIQTYGLHHREEQRVEMVTFVCRVHESSPAQLAG-LTPGDTIASVNGLNVEGIRHREIV 171

  Fly   378 ELLRNTDIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQESQLSMPGSPSIA 442
            ::::.:..|:.|........||.| |:..|..:|.|...                          
Mouse   172 DIIKASGNVLRLETLYGTSIRKAE-LEARLQYLKQTLYE-------------------------- 209

  Fly   443 TLSWLPPKSLDADSIATEGDEAVDAEYVGISGAEDEF-----IELPS-RDTVESNMSHVLDRSDH 501
              .|                    .||..:...|...     ::.|| .||:||..|.:     :
Mouse   210 --KW--------------------GEYRSLMVQEQRLVHGLVVKDPSIYDTLESVRSCL-----Y 247

  Fly   502 SGGLTKDQVPRISPIVPL--TNGRSLILADDSGNDTDE----QC----AEPETETAQARKGSKPE 556
            ..||    :|...|..||  ..|.:...|..:..|||:    .|    |||:        ...|.
Mouse   248 GAGL----LPGSLPFGPLLAAPGSARGGARRAKGDTDDAVYHTCFFGGAEPQ--------ALPPP 300

  Fly   557 TERVKDLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAASP 595
            ....:.||.:..:| |...|.|....|.:..|.|:.|.|
Mouse   301 PPPARALGPSSAET-PASVLFPAPRSTLSRSASVRCAGP 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 22/91 (24%)
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
GraspNP_062391.3 PDZ_signaling 99..184 CDD:238492 22/86 (26%)
Interaction with PSCD3. {ECO:0000269|PubMed:10828067} 180..257 23/135 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.