DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and lnx1

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_005160562.1 Gene:lnx1 ZFINID:ZDB-GENE-030131-9439 Length:769 Species:Danio rerio

Alignment Length:431 Identity:100/432 (23%)
Similarity:162/432 (38%) Gaps:142/432 (33%)


  Fly    33 GVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQTGAQVRLIVAR------- 90
            ||.|..|..||:|.|||||::.|.:|.|...:||..:.|..|.:::.:..:|..||:|       
Zfish   436 GVFIFHLLEGGLAARDGRLRVDDRVLAINGHDLRYGAPEHAALLIQASEDRVHFIVSRQTHIPAP 500

  Fly    91 --------------PVEPTAIDYQTL-ACQAPIIPTK---LLSDPEE---------LSRHLFQNP 128
                          |..|..|::..| :||.|....|   ||.:|.:         :|...:..|
Zfish   501 DILQEAPWNMEGPPPYSPVDIEHTLLDSCQKPACYEKTVTLLKEPHDSLGMTVAGGMSSRGWDLP 565

  Fly   129 SFATAAVAAAAAAAAAAGSGSDGDVGGGGVLDVASLVGLVRGGPAEGTELSAVEPQPSAAVLQLQ 193
            .:.|........       |.:|.:..|.:|  .::.|:...|......::.::...|..|||:.
Zfish   566 VYVTNVDPNGVV-------GQEGSIRKGDIL--LNVNGVDLTGVTRSEAVANLKNTSSPVVLQVL 621

  Fly   194 QL---SELAGDLADFPLPPIPGGGGHSMVTDSNAGQRPCPRLDLDIVPFSILSPPPRPALQMLPL 255
            ::   :|.:.|.    :||:     ||          ||......  |..:..|||..  ...||
Zfish   622 EMRPPNESSLDC----MPPL-----HS----------PCALSPSS--PGDVKLPPPND--DYAPL 663

  Fly   256 ETQWRCVQDQNRHI----ETVIADSKRKLLANEDGGSASASGSGSPDSYMDSPETETYVVELHKN 316
            ...|..:.   ||:    :.|:              ..|.|||                      
Zfish   664 WVSWLQLP---RHLYCCKDIVL--------------RRSTSGS---------------------- 689

  Fly   317 VYGLGITVAGYVCEEEDLS---GIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVE 378
               ||.::.|   .:|:|:   ..|::||:||:.|...|:|:..|.::.|:|:|..|:|:...|.
Zfish   690 ---LGFSIVG---GQEELNCNQSFFIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGMTHTALVR 748

  Fly   379 LLRNTDIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPSGL 419
            ||:.            ||||      :.||.:   |.|..|
Zfish   749 LLKE------------LRGR------ITLTIV---SWPGSL 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 22/56 (39%)
PDZ 307..393 CDD:214570 22/89 (25%)
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
lnx1XP_005160562.1 RING 57..93 CDD:214546
PDZ_signaling 297..381 CDD:238492
PDZ_signaling 411..491 CDD:238492 21/55 (38%)
PDZ_signaling 536..621 CDD:238492 17/94 (18%)
DegQ <548..621 CDD:223343 13/82 (16%)
PDZ_signaling 678..762 CDD:238492 33/144 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.