DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and CG6688

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster

Alignment Length:57 Identity:19/58 (33%)
Similarity:33/58 (57%) Gaps:1/58 (2%)


  Fly   625 PHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKLVC 681
            |:.::..:.|..|....| |:|||.:|:||.:.:.|||..|:.|::|.....|.::|
  Fly    50 PYPWVCEVAAGTPAALCG-LKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILC 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570
PDZ_signaling 605..680 CDD:238492 18/55 (33%)
PDZ 773..858 CDD:214570
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.