DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and slc9a3r1a

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_997872.2 Gene:slc9a3r1a ZFINID:ZDB-GENE-031006-7 Length:384 Species:Danio rerio

Alignment Length:506 Identity:96/507 (19%)
Similarity:159/507 (31%) Gaps:221/507 (44%)


  Fly   313 LHKNVYGLGITVAGYVCEEEDLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAV 377
            |.|...|.|..:.|    |::..|.|::.:...|.|..:| :...|::..|:|.::....:.|.|
Zfish    12 LEKGDTGYGFHLHG----EKNKPGQFIRHVEPDSPAAAAG-LLAGDKLALVNGENVEDEKHQQVV 71

  Fly   378 ELLRNT----DIVV------HLTLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQESQ 432
            ..:|:|    ::||      .|.|:..|:.:| |::      ..|...|:|   |:.:|:.:...
Zfish    72 SRIRDTVGKLELVVLNAETAELLLKHNLKCQK-EYV------TDGIPIPAG---SEPEDEVKNGT 126

  Fly   433 LSMPGSPSIATLSWLPPKSLDADSIATEGDEAVDAEYVGISGAEDEFIELPSRDTVESNMSHVLD 497
            .|...:|       :|         .|.||..:|.            :.:.|:|           
Zfish   127 SSRESTP-------VP---------ETNGDMRIDR------------LSVSSKD----------- 152

  Fly   498 RSDHSGGLTKDQV-PRISPIVPLTNGRSLILADDSGNDTDEQCAEPETETAQARKGSKPETERVK 561
                    :|::: ||:..|.....|                            .|....||:.|
Zfish   153 --------SKNELRPRLCHIKKGATG----------------------------YGFNLHTEKTK 181

  Fly   562 DLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPTAASLRVAWKSLGISLEGTVDVECGIEKRPH 626
                            |||                                              
Zfish   182 ----------------PGQ---------------------------------------------- 184

  Fly   627 HYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKLVCARGTHVPSVI 691
             |||::..|.|..:.| |||.|:::|||...:..::|.|||..:|......||:..         
Zfish   185 -YIRAVDEDSPAEKSG-LRPQDKIVQVNGISVHTMQHSEVVAAIKAGGDETKLLVV--------- 238

  Fly   692 NTSQNPEA---FETRSLLPGGHQSLQNLL--------------------SKAQSESSLYTSSTAT 733
                :|||   |.:..:|| ..:.|...|                    .|.:.|.||.:|||::
Zfish   239 ----DPEADAFFMSCEILP-TEEHLTGPLPEPIPRREAEEQVNGKVVQEEKPKVEMSLSSSSTSS 298

  Fly   734 LTDAGAAAGGSGGTAGGGA-------------------RSKSLENVSGLAL 765
            .|...||...:...|...|                   :.|:....:||||
Zfish   299 NTSTSAAPAPASAPAPASAPAPASAPAPAMAAAPQEKVKEKASSADAGLAL 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 22/90 (24%)
PDZ_signaling 605..680 CDD:238492 20/75 (27%)
PDZ 773..858 CDD:214570
slc9a3r1aNP_997872.2 PDZ_signaling 7..86 CDD:238492 20/79 (25%)
PDZ_signaling 159..238 CDD:238492 31/171 (18%)
EBP50_C 242..384 CDD:312529 23/110 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.